Property Summary

NCBI Gene PubMed Count 36
PubMed Score 44.40
PubTator Score 26.40

Knowledge Summary


No data available


  Disease (7)

Disease Target Count Z-score Confidence
Senior-Loken Syndrome 5 1 0.0 0.0
Disease Target Count P-value
malignant mesothelioma 3232 1.5e-06
sonic hedgehog group medulloblastoma 467 4.2e-06
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Crohn's disease 321 0.0 0.9


  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 1.200 1.5e-06
sonic hedgehog group medulloblastoma 1.200 4.2e-06

Gene RIF (15)

AA Sequence

QAPWWKKLGEESGDEIDVPKDELSIELENLFIGGTKPP                                    561 - 598

Text Mined References (35)

PMID Year Title