Property Summary

NCBI Gene PubMed Count 12
Grant Count 74
R01 Count 55
Funding $12,012,119.74
PubMed Score 534.34
PubTator Score 26.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Cerebrovascular disease 231 3.169 1.6

Expression

Synonym

Accession Q15050 Q9BUX8
Symbols

Gene

 GO Function (1)

Gene RIF (2)

PMID Text
22944692 Positional proteomics analysis identifies the cleavage of human RRS1 ribosome biogenesis regulator homolog (S. cerevisiae) (RRS1) at amino acid residues 222-223 by the HIV-1 protease
19465021 RNA interference experiments revealed that RRS1-depleted cells show abnormalities in chromosome alignment and spindle organization, which result in mitotic delay.

AA Sequence

MEGQSVEELLAKAEQDEAEKLQRITVHKELELQFDLGNLLASDRNPPTGLRCAGPTPEAELQALARDNTQ      1 - 70
LLINQLWQLPTERVEEAIVARLPEPTTRLPREKPLPRPRPLTRWQQFARLKGIRPKKKTNLVWDEVSGQW     71 - 140
RRRWGYQRARDDTKEWLIEVPGNADPLEDQFAKRIQAKKERVAKNELNRLRNLARAHKMQLPSAAGLHPT    141 - 210
GHQSKEELGRAMQVAKVSTASVGRFQERLPKEKVPRGSGKKRKFQPLFGDFAAEKKNQLELLRVMNSKKP    211 - 280
QLDVTRATNKQMREEDQEEAAKRRKMSQKGKRKGGRQGPGGKRKGGPPSQGGKRKGGLGGKMNSGPPGLG    281 - 350
GKRKGGQRPGGKRRK                                                           351 - 365
//

Text Mined References (16)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
19465021 2009 A nucleolar protein RRS1 contributes to chromosome congression.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15635413 2005 Nucleolar proteome dynamics.
More...