Property Summary

NCBI Gene PubMed Count 13
PubMed Score 593.04
PubTator Score 26.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

Gene RIF (2)

AA Sequence

MEGQSVEELLAKAEQDEAEKLQRITVHKELELQFDLGNLLASDRNPPTGLRCAGPTPEAELQALARDNTQ      1 - 70
LLINQLWQLPTERVEEAIVARLPEPTTRLPREKPLPRPRPLTRWQQFARLKGIRPKKKTNLVWDEVSGQW     71 - 140
RRRWGYQRARDDTKEWLIEVPGNADPLEDQFAKRIQAKKERVAKNELNRLRNLARAHKMQLPSAAGLHPT    141 - 210
GHQSKEELGRAMQVAKVSTASVGRFQERLPKEKVPRGSGKKRKFQPLFGDFAAEKKNQLELLRVMNSKKP    211 - 280
QLDVTRATNKQMREEDQEEAAKRRKMSQKGKRKGGRQGPGGKRKGGPPSQGGKRKGGLGGKMNSGPPGLG    281 - 350
GKRKGGQRPGGKRRK                                                           351 - 365
//

Text Mined References (18)

PMID Year Title