Property Summary

NCBI Gene PubMed Count 58
PubMed Score 197.73
PubTator Score 795.84

Knowledge Summary

Patent (11,070)

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytoma 2.000 3.3e-02
atypical teratoid / rhabdoid tumor -2.000 1.7e-02
ependymoma 1.200 1.5e-06
group 3 medulloblastoma -2.900 1.3e-08
lung adenocarcinoma -1.300 1.7e-10
medulloblastoma, large-cell -3.500 1.7e-07
oligodendroglioma 1.500 1.4e-02
osteosarcoma -2.555 7.3e-03
psoriasis -1.800 1.4e-51
tuberculosis 1.100 8.5e-04

Gene RIF (38)

AA Sequence

MTQEPFREELAYDRMPTLERGRQDPASYAPDAKPSDLQLSKRLPPCFSHKTWVFSVLMGSCLLVTSGFSL      1 - 70
YLGNVFPAEMDYLRCAAGSCIPSAIVSFTVSRRNANVIPNFQILFVSTFAVTTTCLIWFGCKLVLNPSAI     71 - 140
NINFNLILLLLLELLMAATVIIAARSSEEDCKKKKGSMSDSANILDEVPFPARVLKSYSVVEVIAGISAV    141 - 210
LGGIIALNVDDSVSGPHLSVTFFWILVACFPSAIASHVAAECPSKCLVEVLIAISSLTSPLLFTASGYLS    211 - 280
FSIMRIVEMFKDYPPAIKPSYDVLLLLLLLVLLLQAGLNTGTAIQCVRFKVSARLQGASWDTQNGPQERL    281 - 350
AGEVARSPLKEFDKEKAWRAVVVQMAQ                                               351 - 377
//

Text Mined References (56)

PMID Year Title