Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
breast carcinoma 1638 4.1e-04
psoriasis 6694 7.3e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (2)

Disease log2 FC p
breast carcinoma 1.800 4.1e-04
psoriasis 1.200 7.3e-04

Synonym

Accession Q15048 A8K0A8 D3DWM8
Symbols LRRC14A

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MHTLVFLSTRQVLQCQPAACQALPLLPRELFPLLFKVAFMDKKTVVLRELVHTWPFPLLSFQQLLQECAH      1 - 70
CSRALLQERPSTESMQAVILGLTARLHTSEPGASTQPLCRKHALRVLDMTGLLDDGVEQDPGTMSMWDCT     71 - 140
AAVARTCIAQQQGGAAEPGPAPIPVEVRVDLRVNRASYAFLREALRSSVGSPLRLCCRDLRAEDLPMRNT    141 - 210
VALLQLLDAGCLRRVDLRFNNLGLRGLSVIIPHVARFQHLASLRLHYVHGDSRQPSVDGEDNFRYFLAQM    211 - 280
GRFTCLRELSMGSSLLSGRLDQLLSTLQSPLESLELAFCALLPEDLRFLARSPHAAHLKKLDLSGNDLSG    281 - 350
SQLAPFQGLLQASAATLLHLELTECQLADTQLLATLPILTQCASLRYLGLYGNPLSMAGLKELLRDSVAQ    351 - 420
AELRTVVHPFPVDCYEGLPWPPPASVLLEASINEEKFARVEAELHQLLLASGRAHVLWTTDIYGRLAADY    421 - 490
FSL                                                                       491 - 493
//

Text Mined References (6)

PMID Year Title