Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
breast carcinoma 1614 4.06495992553909E-4
psoriasis 6685 7.250198126935E-4

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 1.200 0.001
breast carcinoma 1.800 0.000

Synonym

Accession Q15048 A8K0A8 D3DWM8
Symbols LRRC14A

Gene

  Ortholog (9)

Gene RIF (1)

PMID Text
18976975 Knockdown of leucine rich repeat containing 14 (LRRC14) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MHTLVFLSTRQVLQCQPAACQALPLLPRELFPLLFKVAFMDKKTVVLRELVHTWPFPLLSFQQLLQECAH      1 - 70
CSRALLQERPSTESMQAVILGLTARLHTSEPGASTQPLCRKHALRVLDMTGLLDDGVEQDPGTMSMWDCT     71 - 140
AAVARTCIAQQQGGAAEPGPAPIPVEVRVDLRVNRASYAFLREALRSSVGSPLRLCCRDLRAEDLPMRNT    141 - 210
VALLQLLDAGCLRRVDLRFNNLGLRGLSVIIPHVARFQHLASLRLHYVHGDSRQPSVDGEDNFRYFLAQM    211 - 280
GRFTCLRELSMGSSLLSGRLDQLLSTLQSPLESLELAFCALLPEDLRFLARSPHAAHLKKLDLSGNDLSG    281 - 350
SQLAPFQGLLQASAATLLHLELTECQLADTQLLATLPILTQCASLRYLGLYGNPLSMAGLKELLRDSVAQ    351 - 420
AELRTVVHPFPVDCYEGLPWPPPASVLLEASINEEKFARVEAELHQLLLASGRAHVLWTTDIYGRLAADY    421 - 490
FSL                                                                       491 - 493
//

Text Mined References (5)

PMID Year Title
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
7584026 1994 Prediction of the coding sequences of unidentified human genes. I. The coding sequences of 40 new genes (KIAA0001-KIAA0040) deduced by analysis of randomly sampled cDNA clones from human immature myeloid cell line KG-1.