Property Summary

NCBI Gene PubMed Count 54
Grant Count 34
R01 Count 20
Funding $3,154,392.39
PubMed Score 161.39
PubTator Score 66.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma 1.500 0.000
astrocytic glioma 1.100 0.005
ependymoma 1.300 0.006
oligodendroglioma 1.500 0.005
psoriasis -1.300 0.001
osteosarcoma -1.294 0.001
group 3 medulloblastoma 2.100 0.000
atypical teratoid/rhabdoid tumor 1.300 0.000
medulloblastoma, large-cell 1.500 0.000
primitive neuroectodermal tumor 1.400 0.000
intraductal papillary-mucinous adenoma (... 1.200 0.001
lung cancer 1.500 0.000
ovarian cancer 1.300 0.000

Gene RIF (31)

PMID Text
26813693 results indicate that ATF7IP does not directly modulate SETDB1 catalytic activity, suggesting alternate roles, such as affecting cellular localization or mediating interaction with additional binding partners.
26481868 SETDB1 is an oncogene that is frequently up-regulated in human HCCs; the multiplicity of SETDB1 activating mechanisms at the chromosomal, transcriptional, and posttranscriptional levels together facilitates SETDB1 up-regulation in human HCC
26471002 regulates cancer cell growth via methylation of p53
26296461 SETDB1, localized in the nucleus, might undergo degradation by the proteasome and be exported to the cytosol, resulting in its detection mainly in the cytosol.
25715926 Exogenous expression of MyoD reversed transcriptional repression of MyoD promoter-driven lucif-erase reporter by Setdb1 shRNA and rescued myogenic differentiation of C2C12 myoblast cells depleted of endogenous Setdb1.
25569264 Authors demonstrate that a KMT1E-containing complex directly interacts with the FcgammaRIIb promoter and that histone H3 at lysine 9 tri-methylation at this promoter is dependent on Setdb1
25477335 Together, our findings defined an essential role for the KMT1E/SMAD2/3 repressor complex in TGFbeta-mediated lung cancer metastasis.
25404354 Report elevated levels of SETDB1 in non-small lung cancers, associated with neoplasm grading and tumor growth.
25070049 MiR-7, inhibited indirectly by lincRNA HOTAIR, directly inhibits SETDB1 and reverses the Epithelial-mesenchymal transition of breast cancer stem cells by down regulating the STAT3 pathway
24760766 This observation suggests that the ZNF274/SETDB1 complex bound to the SNORD116 cluster may protect the Prader-Willi syndrome induced pluripotent cells from DNA demethylation during early development.
More...

AA Sequence

MSSLPGCIGLDAATATVESEEIAELQQAVVEELGISMEELRHFIDEELEKMDCVQQRKKQLAELETWVIQ      1 - 70
KESEVAHVDQLFDDASRAVTNCESLVKDFYSKLGLQYRDSSSEDESSRPTEIIEIPDEDDDVLSIDSGDA     71 - 140
GSRTPKDQKLREAMAALRKSAQDVQKFMDAVNKKSSSQDLHKGTLSQMSGELSKDGDLIVSMRILGKKRT    141 - 210
KTWHKGTLIAIQTVGPGKKYKVKFDNKGKSLLSGNHIAYDYHPPADKLYVGSRVVAKYKDGNQVWLYAGI    211 - 280
VAETPNVKNKLRFLIFFDDGYASYVTQSELYPICRPLKKTWEDIEDISCRDFIEEYVTAYPNRPMVLLKS    281 - 350
GQLIKTEWEGTWWKSRVEEVDGSLVRILFLDDKRCEWIYRGSTRLEPMFSMKTSSASALEKKQGQLRTRP    351 - 420
NMGAVRSKGPVVQYTQDLTGTGTQFKPVEPPQPTAPPAPPFPPAPPLSPQAGDSDLESQLAQSRKQVAKK    421 - 490
STSFRPGSVGSGHSSPTSPALSENVSGGKPGINQTYRSPLGSTASAPAPSALPAPPAPPVFHGMLERAPA    491 - 560
EPSYRAPMEKLFYLPHVCSYTCLSRVRPMRNEQYRGKNPLLVPLLYDFRRMTARRRVNRKMGFHVIYKTP    561 - 630
CGLCLRTMQEIERYLFETGCDFLFLEMFCLDPYVLVDRKFQPYKPFYYILDITYGKEDVPLSCVNEIDTT    631 - 700
PPPQVAYSKERIPGKGVFINTGPEFLVGCDCKDGCRDKSKCACHQLTIQATACTPGGQINPNSGYQYKRL    701 - 770
EECLPTGVYECNKRCKCDPNMCTNRLVQHGLQVRLQLFKTQNKGWGIRCLDDIAKGSFVCIYAGKILTDD    771 - 840
FADKEGLEMGDEYFANLDHIESVENFKEGYESDAPCSSDSSGVDLKDQEDGNSGTEDPEESNDDSSDDNF    841 - 910
CKDEDFSTSSVWRSYATRRQTRGQKENGLSETTSKDSHPPDLGPPHIPVPPSIPVGGCNPPSSEETPKNK    911 - 980
VASWLSCNSVSEGGFADSDSHSSFKTNEGGEGRAGGSRMEAEKASTSGLGIKDEGDIKQAKKEDTDDRNK    981 - 1050
MSVVTESSRNYGYNPSPVKPEGLRRPPSKTSMHQSRRLMASAQSNPDDVLTLSSSTESEGESGTSRKPTA   1051 - 1120
GQTSATAVDSDDIQTISSGSEGDDFEDKKNMTGPMKRQVAVKSTRGFALKSTHGIAIKSTNMASVDKGES   1121 - 1190
APVRKNTRQFYDGEESCYIIDAKLEGNLGRYLNHSCSPNLFVQNVFVDTHDLRFPWVAFFASKRIRAGTE   1191 - 1260
LTWDYNYEVGSVEGKELLCCCGAIECRGRLL                                          1261 - 1291
//

Text Mined References (67)

PMID Year Title
27029610 2016 ATRX binds to atypical chromatin domains at the 3' exons of zinc finger genes to preserve H3K9me3 enrichment.
26813693 2016 Characterization of the Enzymatic Activity of SETDB1 and Its 1:1 Complex with ATF7IP.
26481868 2016 Up-regulation of histone methyltransferase SETDB1 by multiple mechanisms in hepatocellular carcinoma promotes cancer metastasis.
26471002 2015 Histone methyltransferase SETDB1 regulates liver cancer cell growth through methylation of p53.
26296461 2015 Analysis of the subcellular localization of the human histone methyltransferase SETDB1.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25715926 2015 Setdb1 is required for myogenic differentiation of C2C12 myoblast cells via maintenance of MyoD expression.
25569264 2015 KMT1E-mediated chromatin modifications at the Fc?RIIb promoter regulate thymocyte development.
25477335 2014 H3K9 histone methyltransferase, KMT1E/SETDB1, cooperates with the SMAD2/3 pathway to suppress lung cancer metastasis.
More...