Property Summary

NCBI Gene PubMed Count 68
PubMed Score 181.61
PubTator Score 66.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma 1.500 2.2e-07
astrocytic glioma 1.100 4.6e-03
atypical teratoid / rhabdoid tumor 1.200 1.7e-06
ependymoma 1.300 5.7e-03
group 3 medulloblastoma 2.100 3.1e-06
intraductal papillary-mucinous adenoma (... 1.200 7.1e-04
lung cancer 1.100 1.5e-02
medulloblastoma, large-cell 1.500 2.2e-05
oligodendroglioma 1.500 4.6e-03
osteosarcoma -1.294 7.1e-04
ovarian cancer 1.300 2.5e-05
primitive neuroectodermal tumor 1.400 7.2e-05
psoriasis -1.300 1.3e-03

Protein-protein Interaction (10)

Gene RIF (44)

AA Sequence

MSSLPGCIGLDAATATVESEEIAELQQAVVEELGISMEELRHFIDEELEKMDCVQQRKKQLAELETWVIQ      1 - 70
KESEVAHVDQLFDDASRAVTNCESLVKDFYSKLGLQYRDSSSEDESSRPTEIIEIPDEDDDVLSIDSGDA     71 - 140
GSRTPKDQKLREAMAALRKSAQDVQKFMDAVNKKSSSQDLHKGTLSQMSGELSKDGDLIVSMRILGKKRT    141 - 210
KTWHKGTLIAIQTVGPGKKYKVKFDNKGKSLLSGNHIAYDYHPPADKLYVGSRVVAKYKDGNQVWLYAGI    211 - 280
VAETPNVKNKLRFLIFFDDGYASYVTQSELYPICRPLKKTWEDIEDISCRDFIEEYVTAYPNRPMVLLKS    281 - 350
GQLIKTEWEGTWWKSRVEEVDGSLVRILFLDDKRCEWIYRGSTRLEPMFSMKTSSASALEKKQGQLRTRP    351 - 420
NMGAVRSKGPVVQYTQDLTGTGTQFKPVEPPQPTAPPAPPFPPAPPLSPQAGDSDLESQLAQSRKQVAKK    421 - 490
STSFRPGSVGSGHSSPTSPALSENVSGGKPGINQTYRSPLGSTASAPAPSALPAPPAPPVFHGMLERAPA    491 - 560
EPSYRAPMEKLFYLPHVCSYTCLSRVRPMRNEQYRGKNPLLVPLLYDFRRMTARRRVNRKMGFHVIYKTP    561 - 630
CGLCLRTMQEIERYLFETGCDFLFLEMFCLDPYVLVDRKFQPYKPFYYILDITYGKEDVPLSCVNEIDTT    631 - 700
PPPQVAYSKERIPGKGVFINTGPEFLVGCDCKDGCRDKSKCACHQLTIQATACTPGGQINPNSGYQYKRL    701 - 770
EECLPTGVYECNKRCKCDPNMCTNRLVQHGLQVRLQLFKTQNKGWGIRCLDDIAKGSFVCIYAGKILTDD    771 - 840
FADKEGLEMGDEYFANLDHIESVENFKEGYESDAPCSSDSSGVDLKDQEDGNSGTEDPEESNDDSSDDNF    841 - 910
CKDEDFSTSSVWRSYATRRQTRGQKENGLSETTSKDSHPPDLGPPHIPVPPSIPVGGCNPPSSEETPKNK    911 - 980
VASWLSCNSVSEGGFADSDSHSSFKTNEGGEGRAGGSRMEAEKASTSGLGIKDEGDIKQAKKEDTDDRNK    981 - 1050
MSVVTESSRNYGYNPSPVKPEGLRRPPSKTSMHQSRRLMASAQSNPDDVLTLSSSTESEGESGTSRKPTA   1051 - 1120
GQTSATAVDSDDIQTISSGSEGDDFEDKKNMTGPMKRQVAVKSTRGFALKSTHGIAIKSTNMASVDKGES   1121 - 1190
APVRKNTRQFYDGEESCYIIDAKLEGNLGRYLNHSCSPNLFVQNVFVDTHDLRFPWVAFFASKRIRAGTE   1191 - 1260
LTWDYNYEVGSVEGKELLCCCGAIECRGRLL                                          1261 - 1291
//

Text Mined References (82)

PMID Year Title