Property Summary

NCBI Gene PubMed Count 56
PubMed Score 265.80
PubTator Score 139.11

Knowledge Summary


No data available


  Differential Expression (13)


Accession Q15046 A8MSK1 D3DUK4 O14946 Q96J25 Q9HB23
Symbols KRS



3BJU   4DPG   4YCU   4YCW  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (56)

26643967 finding show that enzymatically active Shiga toxins trigger the dissociation of lysyl-tRNA synthetase (KRS) from the multi-aminoacyl-tRNA synthetase complex in human macrophage-like differentiated THP-1 cells and its subsequent secretion.
26091349 KRS at the plasma membrane plays new roles in metastatic migration as a signaling inducer, and causes intracellular signaling for cancer dissemination
25918939 tRK1 forms a complex with human enolases and interacts with tRK1 and human pre-lysyl-tRNA synthetase (preKARS2)
25010285 Homodimeric lysyl-tRNA synthetase dissociates into a monomer that bridges between HIV-1 Gag and tRNA(Lys3)
24983501 structural characteristics of the KRS-LR interaction on the cell surface
23972532 Lysyl-tRNA synthetase plays essential role in HIV replication, transcriptional regulation, cytokine-like signaling. [review]
23799079 The role of preKARS2 in the tRNA mitochondrial import.
23768514 The KARS variant is identified in two families affected by DFNB89-associated autosomal-recessive nonsyndromic hearing impairment.
23208549 C-terminal domain of HIV-1 capsid protein as surrogate for human lysyl tRNA synthetase
23208549 Homodimeric lysyl-tRNA synthetase dissociates into a monomer that bridges between HIV-1 Gag and tRNA(Lys3)
23159739 A single conformational change triggered by phosphorylation leads to multiple effects driving an exclusive switch of LysRS function from translation to transcription.
23095741 Dual role for motif 1 residues of human lysyl-tRNA synthetase in dimerization and packaging into HIV-1.
23095741 Homodimeric lysyl-tRNA synthetase dissociates into a monomer that bridges between HIV-1 Gag and tRNA(Lys3)
22751010 The work thus unveiled a unique function of KRS in the control of cell migration and its pathological implication in metastasis.
22698876 Homodimeric lysyl-tRNA synthetase dissociates into a monomer that bridges between HIV-1 Gag and tRNA(Lys3)
22276994 Homodimeric lysyl-tRNA synthetase dissociates into a monomer that bridges between HIV-1 Gag and tRNA(Lys3)
22235746 Data are consistent with hypothesis that maturation of cytoplasmic KARS precursor is needed to reveal the potent tRNA binding properties of mitochondrial KARS.
22190034 Homodimeric lysyl-tRNA synthetase dissociates into a monomer that bridges between HIV-1 Gag and tRNA(Lys3)
21994608 Homodimeric lysyl-tRNA synthetase dissociates into a monomer that bridges between HIV-1 Gag and tRNA(Lys3)
21763493 LysRS associates with the Pol domain of GagPol.
21763493 Homodimeric lysyl-tRNA synthetase dissociates into a monomer that bridges between HIV-1 Gag and tRNA(Lys3)
21536907 The results suggest that this unique geometry, which reconfigures the LysRS tetramer from alpha(2):alpha(2) to alpha(2)beta(1):beta(1)alpha(2), is designed to control both retention and mobilization of LysRS from the multi-tRNA synthetase complex
21318276 Homodimeric lysyl-tRNA synthetase dissociates into a monomer that bridges between HIV-1 Gag and tRNA(Lys3)
21093454 The interaction between helix 7 of LysRS and helix 4 of the capsid C-terminal domain of HIV-1 Gag (HIV-CA-CTD) was studied using circular dichromism spectroscopy and molecular dynamics simulation.
21093454 Homodimeric lysyl-tRNA synthetase dissociates into a monomer that bridges between HIV-1 Gag and tRNA(Lys3)
21058683 Homodimeric lysyl-tRNA synthetase dissociates into a monomer that bridges between HIV-1 Gag and tRNA(Lys3)
20920668 Loss-of-function lysyl-tRNA synthetase mutations associated with peripheral neuropathy and Charcot-Marie-Tooth disease.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20699648 These results underscore the contribution of KARS to the emission of (one of) the principal signal(s) of immunogenic cell death, CRT exposure.
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19914238 Homodimeric lysyl-tRNA synthetase dissociates into a monomer that bridges between HIV-1 Gag and tRNA(Lys3)
19844255 Observational study of gene-disease association. (HuGE Navigator)
19825046 Homodimeric lysyl-tRNA synthetase dissociates into a monomer that bridges between HIV-1 Gag and tRNA(Lys3)
19458171 Homodimeric lysyl-tRNA synthetase dissociates into a monomer that bridges between HIV-1 Gag and tRNA(Lys3)
18854154 Knockdown of lysyl-tRNA synthetase (KARS) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18842718 Homodimeric lysyl-tRNA synthetase dissociates into a monomer that bridges between HIV-1 Gag and tRNA(Lys3)
18715867 mitoKARS is the first described member of a group of mitochondrial proteins whose interaction with mutant SOD1 contributes to mitochondrial dysfunction in ALS
18708237 Homodimeric lysyl-tRNA synthetase dissociates into a monomer that bridges between HIV-1 Gag and tRNA(Lys3)
18272479 present a 2.3-A crystal structure of a tetrameric form of human LysRS
17724017 This work reports further characterization of the interaction between HIV-1 capsid domain of Gag and human LysRS using truncation constructs and point mutations in the putative interaction helices.
17724017 Homodimeric lysyl-tRNA synthetase dissociates into a monomer that bridges between HIV-1 Gag and tRNA(Lys3)
17560997 HIV-1 Vpr fulfills an essential role in the process of packaging of mitochondrial Lysyl-tRNA synthase.
17560997 Homodimeric lysyl-tRNA synthetase dissociates into a monomer that bridges between HIV-1 Gag and tRNA(Lys3)
16702215 analysis of the interaction between HIV-1 Gag and human lysyl-tRNA synthetase
16702215 Homodimeric lysyl-tRNA synthetase dissociates into a monomer that bridges between HIV-1 Gag and tRNA(Lys3)
16120388 Homodimeric lysyl-tRNA synthetase dissociates into a monomer that bridges between HIV-1 Gag and tRNA(Lys3)
15888436 Homodimeric lysyl-tRNA synthetase dissociates into a monomer that bridges between HIV-1 Gag and tRNA(Lys3)
15220430 packaged into human immunodeficiency virus type 1 (HIV-1) via its interaction with Gag; this enzyme facilitates the selective packaging of tRNA(3)(Lys), the primer for initiating reverse transcription, into HIV-1
15220430 Homodimeric lysyl-tRNA synthetase dissociates into a monomer that bridges between HIV-1 Gag and tRNA(Lys3)
15183344 Homodimeric lysyl-tRNA synthetase dissociates into a monomer that bridges between HIV-1 Gag and tRNA(Lys3)
15142377 Homodimeric lysyl-tRNA synthetase dissociates into a monomer that bridges between HIV-1 Gag and tRNA(Lys3)
15078180 Homodimeric lysyl-tRNA synthetase dissociates into a monomer that bridges between HIV-1 Gag and tRNA(Lys3)
12756246 HIV-1 Gag interacts with human lysyl-tRNA synthetase during viral assembly
12756246 Homodimeric lysyl-tRNA synthetase dissociates into a monomer that bridges between HIV-1 Gag and tRNA(Lys3)
11333884 Homodimeric lysyl-tRNA synthetase dissociates into a monomer that bridges between HIV-1 Gag and tRNA(Lys3)
9525626 Homodimeric lysyl-tRNA synthetase dissociates into a monomer that bridges between HIV-1 Gag and tRNA(Lys3)

AA Sequence

SNNIKEVLLFPAMKPEDKKENVATTDTLESTTVGTSV                                     561 - 597

Text Mined References (68)

PMID Year Title
26643967 2016 Shiga Toxins Trigger the Secretion of Lysyl-tRNA Synthetase to Enhance Proinflammatory Responses.
26091349 2015 Noncanonical roles of membranous lysyl-tRNA synthetase in transducing cell-substrate signaling for invasive dissemination of colon cancer spheroids in 3D collagen I gels.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25918939 2015 A Moonlighting Human Protein Is Involved in Mitochondrial Import of tRNA.
25416956 2014 A proteome-scale map of the human interactome network.
25086665 2014 Genome-wide association study identifies multiple susceptibility loci for pancreatic cancer.
24983501 2014 Characterization of the interaction between lysyl-tRNA synthetase and laminin receptor by NMR.
23972532 2013 Non-canonical roles of lysyl-tRNA synthetase in health and disease.
23799079 2013 Induced tRNA import into human mitochondria: implication of a host aminoacyl-tRNA-synthetase.
23768514 2013 Mutations in KARS, encoding lysyl-tRNA synthetase, cause autosomal-recessive nonsyndromic hearing impairment DFNB89.
23208549 2013 Escherichia coli LysU is a potential surrogate for human lysyl tRNA synthetase in interactions with the C-terminal domain of HIV-1 capsid protein.
23159739 2013 Structural switch of lysyl-tRNA synthetase between translation and transcription.
23095741 2012 Dual role for motif 1 residues of human lysyl-tRNA synthetase in dimerization and packaging into HIV-1.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22751010 2012 Interaction of two translational components, lysyl-tRNA synthetase and p40/37LRP, in plasma membrane promotes laminin-dependent cell migration.
22235746 2012 Activation of human mitochondrial lysyl-tRNA synthetase upon maturation of its premitochondrial precursor.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21900206 2011 A directed protein interaction network for investigating intracellular signal transduction.
21763493 2011 Association of mitochondrial Lysyl-tRNA synthetase with HIV-1 GagPol involves catalytic domain of the synthetase and transframe and integrase domains of Pol.
21536907 2011 Structural context for mobilization of a human tRNA synthetase from its cytoplasmic complex.
21269460 2011 Initial characterization of the human central proteome.
21181198 2011 DFNB89, a novel autosomal recessive nonsyndromic hearing impairment locus on chromosome 16q21-q23.2.
21093454 2011 In vitro and in silico binding study of the peptide derived from HIV-1 CA-CTD and LysRS as a potential HIV-1 blocking site.
20920668 2010 Compound heterozygosity for loss-of-function lysyl-tRNA synthetase mutations in a patient with peripheral neuropathy.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20699648 2010 Lysyl tRNA synthetase is required for the translocation of calreticulin to the cell surface in immunogenic death.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
19844255 2010 Fine mapping and association studies of a high-density lipoprotein cholesterol linkage region on chromosome 16 in French-Canadian subjects.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18715867 2008 Lysyl-tRNA synthetase is a target for mutant SOD1 toxicity in mitochondria.
18272479 2008 Crystal structure of tetrameric form of human lysyl-tRNA synthetase: Implications for multisynthetase complex formation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18029264 2008 Lysyl-tRNA synthetase interacts with EF1alpha, aspartyl-tRNA synthetase and p38 in vitro.
17724017 2007 Critical role of helix 4 of HIV-1 capsid C-terminal domain in interactions with human lysyl-tRNA synthetase.
17560997 2007 Role of HIV-1 Vpr-induced apoptosis on the release of mitochondrial lysyl-tRNA synthetase.
16702215 2006 In vitro characterization of the interaction between HIV-1 Gag and human lysyl-tRNA synthetase.
16341674 2005 Transcriptome analysis of human gastric cancer.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
16055448 2005 The C-terminal appended domain of human cytosolic leucyl-tRNA synthetase is indispensable in its interaction with arginyl-tRNA synthetase in the multi-tRNA synthetase complex.
15851690 2005 Human lysyl-tRNA synthetase is secreted to trigger proinflammatory response.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15220430 2004 Cellular distribution of Lysyl-tRNA synthetase and its interaction with Gag during human immunodeficiency virus type 1 assembly.
14975237 2004 The function of lysyl-tRNA synthetase and Ap4A as signaling regulators of MITF activity in FcepsilonRI-activated mast cells.
14659874 2003 The telomeric protein Rap1 is conserved in vertebrates and is expressed from a bidirectional promoter positioned between the Rap1 and KARS genes.
12869526 2003 HCC-associated protein HCAP1, a variant of GEMIN4, interacts with zinc-finger proteins.
12819782 2003 Downregulation of FUSE-binding protein and c-myc by tRNA synthetase cofactor p38 is required for lung cell differentiation.
12756246 2003 The interaction between HIV-1 Gag and human lysyl-tRNA synthetase during viral assembly.
12729910 2003 Solution structure and p43 binding of the p38 leucine zipper motif: coiled-coil interactions mediate the association between p38 and p43.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11829477 2002 Interaction network of human aminoacyl-tRNA synthetases and subunits of elongation factor 1 complex.
11714285 2001 The appended C-domain of human methionyl-tRNA synthetase has a tRNA-sequestering function.
11333884 2001 Incorporation of lysyl-tRNA synthetase into human immunodeficiency virus type 1.
10952987 2000 The human lysyl-tRNA synthetase gene encodes both the cytoplasmic and mitochondrial enzymes by means of an unusual alternative splicing of the primary transcript.
9878398 1999 Macromolecular assemblage of aminoacyl-tRNA synthetases: identification of protein-protein interactions and characterization of a core protein.
9525626 1998 Human immunodeficiency virus type 1 (HIV-1) viral protein R (Vpr) interacts with Lys-tRNA synthetase: implications for priming of HIV-1 reverse transcription.
9278442 1997 Human lysyl-tRNA synthetase accepts nucleotide 73 variants and rescues Escherichia coli double-defective mutant.
8812440 1996 Assignment of two human autoantigen genes-isoleucyl-tRNA synthetase locates to 9q21 and lysyl-tRNA synthetase locates to 16q23-q24.
8449960 1993 Expression of human aspartyl-tRNA synthetase in Escherichia coli. Functional analysis of the N-terminal putative amphiphilic helix.
8188258 1994 The human EPRS locus (formerly the QARS locus): a gene encoding a class I and a class II aminoacyl-tRNA synthetase.
8078941 1994 Evolution of the Glx-tRNA synthetase family: the glutaminyl enzyme as a case of horizontal gene transfer.
8052601 1994 Human cytoplasmic isoleucyl-tRNA synthetase: selective divergence of the anticodon-binding domain and acquisition of a new structural unit.
7584044 1994 Prediction of the coding sequences of unidentified human genes. II. The coding sequences of 40 new genes (KIAA0041-KIAA0080) deduced by analysis of cDNA clones from human cell line KG-1.
5338216 1966 Enzymatic synthesis of diadenosine tetraphosphate and diadenosine triphosphate with a purified lysyl-sRNA synthetase.
1651330 1991 Structural analysis of the high molecular mass aminoacyl-tRNA synthetase complex. Effects of neutral salts and detergents.