Property Summary

NCBI Gene PubMed Count 56
Grant Count 116
R01 Count 83
Funding $20,515,824.93
PubMed Score 265.80
PubTator Score 139.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Synonym

Accession Q15046 A8MSK1 D3DUK4 O14946 Q96J25 Q9HB23
Symbols KRS
KARS1
KARS2
CMTRIB
DFNB89

Gene

PDB

3BJU   4DPG   4YCU   4YCW  

Gene RIF (80)

PMID Text
26643967 finding show that enzymatically active Shiga toxins trigger the dissociation of lysyl-tRNA synthetase (KRS) from the multi-aminoacyl-tRNA synthetase complex in human macrophage-like differentiated THP-1 cells and its subsequent secretion.
26091349 KRS at the plasma membrane plays new roles in metastatic migration as a signaling inducer, and causes intracellular signaling for cancer dissemination
25918939 tRK1 forms a complex with human enolases and interacts with tRK1 and human pre-lysyl-tRNA synthetase (preKARS2)
25010285 Homodimeric lysyl-tRNA synthetase dissociates into a monomer that bridges between HIV-1 Gag and tRNA(Lys3)
24983501 structural characteristics of the KRS-LR interaction on the cell surface
23972532 Lysyl-tRNA synthetase plays essential role in HIV replication, transcriptional regulation, cytokine-like signaling. [review]
23799079 The role of preKARS2 in the tRNA mitochondrial import.
23768514 The KARS variant is identified in two families affected by DFNB89-associated autosomal-recessive nonsyndromic hearing impairment.
23208549 C-terminal domain of HIV-1 capsid protein as surrogate for human lysyl tRNA synthetase
23208549 Homodimeric lysyl-tRNA synthetase dissociates into a monomer that bridges between HIV-1 Gag and tRNA(Lys3)
More...

AA Sequence

MAAVQAAEVKVDGSEPKLSKNELKRRLKAEKKVAEKEAKQKELSEKQLSQATAAATNHTTDNGVGPEEES      1 - 70
VDPNQYYKIRSQAIHQLKVNGEDPYPHKFHVDISLTDFIQKYSHLQPGDHLTDITLKVAGRIHAKRASGG     71 - 140
KLIFYDLRGEGVKLQVMANSRNYKSEEEFIHINNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCL    141 - 210
HMLPHLHFGLKDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVA    211 - 280
KPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDL    281 - 350
MEITEKMVSGMVKHITGSYKVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKALGMKLPETNLFETEETR    351 - 420
KILDDICVAKAVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFV    421 - 490
MKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTD    491 - 560
SNNIKEVLLFPAMKPEDKKENVATTDTLESTTVGTSV                                     561 - 597
//

Text Mined References (68)

PMID Year Title
26643967 2016 Shiga Toxins Trigger the Secretion of Lysyl-tRNA Synthetase to Enhance Proinflammatory Responses.
26091349 2015 Noncanonical roles of membranous lysyl-tRNA synthetase in transducing cell-substrate signaling for invasive dissemination of colon cancer spheroids in 3D collagen I gels.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25918939 2015 A Moonlighting Human Protein Is Involved in Mitochondrial Import of tRNA.
25416956 2014 A proteome-scale map of the human interactome network.
25086665 2014 Genome-wide association study identifies multiple susceptibility loci for pancreatic cancer.
24983501 2014 Characterization of the interaction between lysyl-tRNA synthetase and laminin receptor by NMR.
23972532 2013 Non-canonical roles of lysyl-tRNA synthetase in health and disease.
23799079 2013 Induced tRNA import into human mitochondria: implication of a host aminoacyl-tRNA-synthetase.
23768514 2013 Mutations in KARS, encoding lysyl-tRNA synthetase, cause autosomal-recessive nonsyndromic hearing impairment DFNB89.
More...