Property Summary

NCBI Gene PubMed Count 24
Grant Count 33
R01 Count 25
Funding $2,537,346.53
PubMed Score 39.93
PubTator Score 28.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
ependymoma 1.200 0.006
Barrett's esophagus 2.500 0.015
esophageal adenocarcinoma 3.000 0.018
glioblastoma 2.200 0.043
osteosarcoma 2.123 0.001
group 4 medulloblastoma -1.900 0.000
atypical teratoid / rhabdoid tumor 1.300 0.003
medulloblastoma, large-cell 1.500 0.000
primary pancreatic ductal adenocarcinoma -1.501 0.009
non-small cell lung cancer 1.190 0.000
lung cancer 1.700 0.000
interstitial cystitis 1.400 0.000
cystic fibrosis 1.100 0.004
non primary Sjogren syndrome sicca -1.200 0.017
nasopharyngeal carcinoma 1.600 0.000
psoriasis -1.100 0.000
Endometriosis -2.834 0.021
lung carcinoma 1.700 0.000
ulcerative colitis -1.100 0.006
ovarian cancer 2.800 0.000
pituitary cancer -1.300 0.001
pancreatic cancer -1.500 0.004
head and neck cancer 1.600 0.001

Gene RIF (17)

PMID Text
24927598 Asparagine-linked (N-linked) glycosylation of ZIP14, particularly the glycosylation at N102, was required for efficient membrane extraction of ZIP14 and therefore is necessary for its iron sensitivity.
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of solute carrier family 39, member 14 (SLC39A14) in primary human brain microvascular endothelial cells
24576911 These results suggest that both the up-regulation of ZIP14 and the down-regulation of ZnT10 by IL-6 might have enhanced the accumulation of manganese in SH-SY5Y cells.
24514587 Polymorphisms in SLC39A14 and SLC39A8 seemed to affect blood cadmium concentrations, for SLC39A14 this effect may occur via differential gene expression.
23110240 Data show the role of ZIP14 in the hepatocyte is multi-functional since zinc and iron trafficking are altered in the Zip14(-/-) mice and their phenotype shows defects in glucose homeostasis.
23052185 Zip14 expression induced by lipopolysaccharides in macrophages attenuates inflammatory response
22318508 Observations indicate that ZIP14 and ZIP8 are both broad-scope metal-ion transporters that can mediate the cellular uptake of nutritionally important metals as well as the toxic heavy metal cadmium.
22173985 the SLC39A14-exon4B transcript variant is a colorectal cancer biomarker with high sensitivity and organ-confined specificity.
22137264 Data suggest that Zip-14 mRNA level in enterocytes increases with iron or zinc depletion; Zip-14 transcript level in enterocytes decreases with zinc supplementation.
21462106 The transporter ZIP14 is up-regulated along the entire gastrointestinal tract by proinflammatory conditions.
More...

AA Sequence

MKLLLLHPAFQSCLLLTLLGLWRTTPEAHASSLGAPAISAASFLQDLIHRYGEGDSLTLQQLKALLNHLD      1 - 70
VGVGRGNVTQHVQGHRNLSTCFSSGDLFTAHNFSEQSRIGSSELQEFCPTILQQLDSRACTSENQENEEN     71 - 140
EQTEEGRPSAVEVWGYGLLCVTVISLCSLLGASVVPFMKKTFYKRLLLYFIALAIGTLYSNALFQLIPEA    141 - 210
FGFNPLEDYYVSKSAVVFGGFYLFFFTEKILKILLKQKNEHHHGHSHYASESLPSKKDQEEGVMEKLQNG    211 - 280
DLDHMIPQHCSSELDGKAPMVDEKVIVGSLSVQDLQASQSACYWLKGVRYSDIGTLAWMITLSDGLHNFI    281 - 350
DGLAIGASFTVSVFQGISTSVAILCEEFPHELGDFVILLNAGMSIQQALFFNFLSACCCYLGLAFGILAG    351 - 420
SHFSANWIFALAGGMFLYISLADMFPEMNEVCQEDERKGSILIPFIIQNLGLLTGFTIMVVLTMYSGQIQ    421 - 490
IG                                                                        491 - 492
//

Text Mined References (31)

PMID Year Title
27231142 2016 Mutations in SLC39A14 disrupt manganese homeostasis and cause childhood-onset parkinsonism-dystonia.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
24927598 2014 An iron-regulated and glycosylation-dependent proteasomal degradation pathway for the plasma membrane metal transporter ZIP14.
24576911 2014 Interleukin-6 enhances manganese accumulation in SH-SY5Y cells: implications of the up-regulation of ZIP14 and the down-regulation of ZnT10.
24514587 2014 Cadmium concentrations in human blood and urine are associated with polymorphisms in zinc transporter genes.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23110240 2012 Zinc transporter ZIP14 functions in hepatic zinc, iron and glucose homeostasis during the innate immune response (endotoxemia).
23052185 2013 Zip14 expression induced by lipopolysaccharides in macrophages attenuates inflammatory response.
22318508 2012 Physiologic implications of metal-ion transport by ZIP14 and ZIP8.
22173985 2012 The exon-level biomarker SLC39A14 has organ-confined cancer-specificity in colorectal cancer.
More...