Property Summary

NCBI Gene PubMed Count 42
PubMed Score 48.46
PubTator Score 28.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.300 3.0e-03
Barrett's esophagus 2.500 1.5e-02
cystic fibrosis 1.100 4.4e-03
Endometriosis -2.173 8.4e-03
ependymoma 1.200 5.8e-03
esophageal adenocarcinoma 3.000 1.8e-02
glioblastoma 2.200 4.3e-02
group 3 medulloblastoma -1.500 4.6e-02
head and neck cancer 1.600 8.6e-04
interstitial cystitis 1.400 3.9e-05
lung cancer 1.600 1.1e-03
lung carcinoma 1.700 3.5e-17
medulloblastoma, large-cell 1.500 1.9e-04
nasopharyngeal carcinoma 1.600 6.3e-05
non primary Sjogren syndrome sicca -1.200 1.7e-02
non-small cell lung cancer 1.190 2.2e-09
osteosarcoma 2.123 1.0e-03
ovarian cancer 2.800 4.6e-06
pancreatic cancer -1.500 3.9e-03
pituitary cancer -1.300 1.3e-03
primary pancreatic ductal adenocarcinoma -1.501 8.6e-03
psoriasis -1.100 5.2e-06
ulcerative colitis -1.100 5.6e-03

Gene RIF (18)

AA Sequence

MKLLLLHPAFQSCLLLTLLGLWRTTPEAHASSLGAPAISAASFLQDLIHRYGEGDSLTLQQLKALLNHLD      1 - 70
VGVGRGNVTQHVQGHRNLSTCFSSGDLFTAHNFSEQSRIGSSELQEFCPTILQQLDSRACTSENQENEEN     71 - 140
EQTEEGRPSAVEVWGYGLLCVTVISLCSLLGASVVPFMKKTFYKRLLLYFIALAIGTLYSNALFQLIPEA    141 - 210
FGFNPLEDYYVSKSAVVFGGFYLFFFTEKILKILLKQKNEHHHGHSHYASESLPSKKDQEEGVMEKLQNG    211 - 280
DLDHMIPQHCSSELDGKAPMVDEKVIVGSLSVQDLQASQSACYWLKGVRYSDIGTLAWMITLSDGLHNFI    281 - 350
DGLAIGASFTVSVFQGISTSVAILCEEFPHELGDFVILLNAGMSIQQALFFNFLSACCCYLGLAFGILAG    351 - 420
SHFSANWIFALAGGMFLYISLADMFPEMNEVCQEDERKGSILIPFIIQNLGLLTGFTIMVVLTMYSGQIQ    421 - 490
IG                                                                        491 - 492
//

Text Mined References (48)

PMID Year Title