Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.06
PubTator Score 0.80

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 7.98332546791064E-10
ovarian cancer 8492 7.27496514486274E-8
posterior fossa group B ependymoma 1530 6.40044713501103E-7
tuberculosis 1563 5.34297654563072E-6
atypical teratoid / rhabdoid tumor 4369 1.04918438282041E-5
intraductal papillary-mucinous neoplasm (IPMN) 3289 5.59948353507401E-5
glioblastoma 5572 7.00770675626561E-4
medulloblastoma, large-cell 6234 0.00322151146906416
diabetes mellitus 1663 0.0175782249411449
subependymal giant cell astrocytoma 2287 0.0248719331237399
Disease Target Count Z-score Confidence
Machado-Joseph disease 18 3.368 1.7

Expression

  Differential Expression (10)

Synonym

Accession Q15040 A8K712
Symbols dJ508I15.2

Gene

  Ortholog (14)

Gene RIF (1)

PMID Text
18579725 The gain of function studies indicated that Josephin domain containing 1 activate NR5A1 gene expression.

AA Sequence

MSCVPWKGDKAKSESLELPQAAPPQIYHEKQRRELCALHALNNVFQDSNAFTRDTLQEIFQRLSPNTMVT      1 - 70
PHKKSMLGNGNYDVNVIMAALQTKGYEAVWWDKRRDVGVIALTNVMGFIMNLPSSLCWGPLKLPLKRQHW     71 - 140
ICVREVGGAYYNLDSKLKMPEWIGGESELRKFLKHHLRGKNCELLLVVPEEVEAHQSWRTDV            141 - 202
//

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23625928 2013 JosD1, a membrane-targeted deubiquitinating enzyme, is activated by ubiquitination and regulates membrane dynamics, cell motility, and endocytosis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21118805 2011 Crystal structure of a Josephin-ubiquitin complex: evolutionary restraints on ataxin-3 deubiquitinating activity.
19946888 2010 Defining the membrane proteome of NK cells.
18579725 2008 Identification of NR5A1 (SF-1/AD4BP) gene expression modulators by large-scale gain and loss of function studies.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17696782 2007 Josephin domain-containing proteins from a variety of species are active de-ubiquitination enzymes.
More...