Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.72
PubTator Score 0.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 1.3e-04
diabetes mellitus -1.100 1.8e-02
glioblastoma -1.200 7.0e-04
intraductal papillary-mucinous neoplasm ... 1.700 5.6e-05
medulloblastoma, large-cell -1.100 3.2e-03
osteosarcoma -2.430 8.0e-10
ovarian cancer -1.600 7.3e-08
posterior fossa group B ependymoma -1.100 6.4e-07
subependymal giant cell astrocytoma -1.080 2.5e-02
tuberculosis -1.500 5.3e-06

Gene RIF (1)

AA Sequence

MSCVPWKGDKAKSESLELPQAAPPQIYHEKQRRELCALHALNNVFQDSNAFTRDTLQEIFQRLSPNTMVT      1 - 70
PHKKSMLGNGNYDVNVIMAALQTKGYEAVWWDKRRDVGVIALTNVMGFIMNLPSSLCWGPLKLPLKRQHW     71 - 140
ICVREVGGAYYNLDSKLKMPEWIGGESELRKFLKHHLRGKNCELLLVVPEEVEAHQSWRTDV            141 - 202
//

Text Mined References (17)

PMID Year Title