Property Summary

NCBI Gene PubMed Count 32
Grant Count 12
R01 Count 2
Funding $410,425.96
PubMed Score 16.62
PubTator Score 21.82

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.700 0.000

Gene RIF (10)

PMID Text
26202251 The double knockdown of SNX17 and SNX27 results in a striking reduction of papillomavirus 16 infection due to interruption of their binding to the L2 viral protein.
25825439 SNX17 plays a role in the maintenance of normal surface levels of activating receptors and integrins to permit optimum T cell activation at the immune synapse.
25059659 Data indicate that the major binding site for binding of sorting nexin 17 (SNX17) is confined to the NPXF2 motif in cytoplasmic adaptor protein Krev interaction trapped 1 (KRIT1).
24705369 Sorting nexin 17 regulates ApoER2 recycling and reelin signaling.
23115288 The authors demonstrate that SNX17 is essential for infection with all papillomavirus types analyzed, indicating an evolutionarily highly conserved virus entry mechanism.
22492727 depletion of SNX17 in HeLa cells resulted in lysosomal degradation of multiple members of the integrin family of extracellular matrix recep-tors.
18276590 SNX17 regulates amyloid precursor protein trafficking and processing in the early endosomes
16712798 SNX17 has a role in the indicated KRIT1 function in cell adhesion processes by integrin signaling
16052210 Snx 17 binds to a motif in the low-density lipoprotein (LDL) receptor-related protein (LRP) tail distinct from the endocytosis signals and promotes LRP sorting to the recycling pathway in the early endosomes.
15769472 expression level of SNX17 may regulate the lysosomal degradation, at least for P-selectin, by suppressing its entry into the inner vesicles of the multi-vesicular bodies (MVBs)

AA Sequence

MHFSIPETESRSGDSGGSAYVAYNIHVNGVLHCRVRYSQLLGLHEQLRKEYGANVLPAFPPKKLFSLTPA      1 - 70
EVEQRREQLEKYMQAVRQDPLLGSSETFNSFLRRAQQETQQVPTEEVSLEVLLSNGQKVLVNVLTSDQTE     71 - 140
DVLEAVAAKLDLPDDLIGYFSLFLVREKEDGAFSFVRKLQEFELPYVSVTSLRSQEYKIVLRKSYWDSAY    141 - 210
DDDVMENRVGLNLLYAQTVSDIERGWILVTKEQHRQLKSLQEKVSKKEFLRLAQTLRHYGYLRFDACVAD    211 - 280
FPEKDCPVVVSAGNSELSLQLRLPGQQLREGSFRVTRMRCWRVTSSVPLPSGSTSSPGRGRGEVRLELAF    281 - 350
EYLMSKDRLQWVTITSPQAIMMSICLQSMVDELMVKKSGGSIRKMLRRRVGGTLRRSDSQQAVKSPPLLE    351 - 420
SPDATRESMVKLSSKLSAVSLRGIGSPSTDASASDVHGNFAFEGIGDEDL                        421 - 470
//

Text Mined References (41)

PMID Year Title
26202251 2015 A Novel PDZ Domain Interaction Mediates the Binding between Human Papillomavirus 16 L2 and Sorting Nexin 27 and Modulates Virion Trafficking.
25825439 2015 SNX17 affects T cell activation by regulating TCR and integrin recycling.
25059659 2014 Structural determinants for binding of sorting nexin 17 (SNX17) to the cytoplasmic adaptor protein Krev interaction trapped 1 (KRIT1).
24705369 2014 Sorting nexin 17 regulates ApoER2 recycling and reelin signaling.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23726366 2013 Genome-wide characterization of shared and distinct genetic components that influence blood lipid levels in ethnically diverse human populations.
23382219 2013 Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23115288 2013 SNX17 facilitates infection with diverse papillomavirus types.
22747683 2012 Genetic variants associated with breast size also influence breast cancer risk.
More...