Property Summary

NCBI Gene PubMed Count 33
PubMed Score 18.31
PubTator Score 21.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 2.0e-04
Disease Target Count Z-score Confidence
Breast cancer 3578 0.0 1.7
Cardiovascular system disease 246 0.0 3.0

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer -1.200 2.0e-04

Gene RIF (11)

AA Sequence

MHFSIPETESRSGDSGGSAYVAYNIHVNGVLHCRVRYSQLLGLHEQLRKEYGANVLPAFPPKKLFSLTPA      1 - 70
EVEQRREQLEKYMQAVRQDPLLGSSETFNSFLRRAQQETQQVPTEEVSLEVLLSNGQKVLVNVLTSDQTE     71 - 140
DVLEAVAAKLDLPDDLIGYFSLFLVREKEDGAFSFVRKLQEFELPYVSVTSLRSQEYKIVLRKSYWDSAY    141 - 210
DDDVMENRVGLNLLYAQTVSDIERGWILVTKEQHRQLKSLQEKVSKKEFLRLAQTLRHYGYLRFDACVAD    211 - 280
FPEKDCPVVVSAGNSELSLQLRLPGQQLREGSFRVTRMRCWRVTSSVPLPSGSTSSPGRGRGEVRLELAF    281 - 350
EYLMSKDRLQWVTITSPQAIMMSICLQSMVDELMVKKSGGSIRKMLRRRVGGTLRRSDSQQAVKSPPLLE    351 - 420
SPDATRESMVKLSSKLSAVSLRGIGSPSTDASASDVHGNFAFEGIGDEDL                        421 - 470
//

Text Mined References (42)

PMID Year Title