Property Summary

NCBI Gene PubMed Count 19
PubMed Score 7.17
PubTator Score 1.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Astrocytoma, Pilocytic 1.100 1.9e-04
atypical teratoid / rhabdoid tumor 1.300 7.2e-05
ependymoma 1.200 4.9e-11
gastric carcinoma 1.200 1.8e-02
glioblastoma 1.200 2.7e-04
group 3 medulloblastoma 1.300 2.9e-04
interstitial cystitis 1.100 3.3e-03
intraductal papillary-mucinous adenoma (... 1.300 8.3e-03
intraductal papillary-mucinous carcinoma... 1.600 6.8e-03
lung carcinoma -1.100 5.4e-12
osteosarcoma 1.784 2.5e-04
ovarian cancer -1.100 1.1e-06
pancreatic ductal adenocarcinoma liver m... -1.325 6.9e-03
pediatric high grade glioma 1.400 3.2e-06
psoriasis -1.200 2.4e-03
subependymal giant cell astrocytoma 1.829 4.0e-02

Gene RIF (4)

AA Sequence

MAFRRRTKSYPLFSQEFVIHNHADIGFCLVLCVLIGLMFEVTAKTAFLFILPQYNISVPTADSETVHYHY      1 - 70
GPKDLVTILFYIFITIILHAVVQEYILDKISKRLHLSKVKHSKFNESGQLVVFHFTSVIWCFYVVVTEGY     71 - 140
LTNPRSLWEDYPHVHLPFQVKFFYLCQLAYWLHALPELYFQKVRKEEIPRQLQYICLYLVHIAGAYLLNL    141 - 210
SRLGLILLLLQYSTEFLFHTARLFYFADENNEKLFSAWAAVFGVTRLFILTLAVLAIGFGLARMENQAFD    211 - 280
PEKGNFNTLFCRLCVLLLVCAAQAWLMWRFIHSQLRHWREYWNEQSAKRRVPATPRLPARLIKRESGYHE    281 - 350
NGVVKAENGTSPRTKKLKSP                                                      351 - 370
//

Text Mined References (21)

PMID Year Title