Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.90
PubTator Score 1.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma -1.500 8.1e-03
astrocytic glioma -1.100 1.1e-02
Astrocytoma, Pilocytic -1.500 2.0e-04
atypical teratoid / rhabdoid tumor -1.900 1.1e-07
ependymoma -1.500 7.7e-03
glioblastoma -1.200 7.2e-05
group 4 medulloblastoma -1.700 4.4e-03
lung adenocarcinoma 1.200 8.0e-12
lung cancer 1.800 1.4e-04
lung carcinoma 1.300 1.1e-29
medulloblastoma, large-cell -1.600 6.5e-03
Multiple myeloma 1.388 1.3e-03
non-small cell lung cancer 1.052 7.7e-23
oligodendroglioma -1.200 1.8e-19
osteosarcoma 1.870 1.3e-05
ovarian cancer 1.500 2.0e-04
Pick disease -1.500 2.3e-03
primitive neuroectodermal tumor -1.400 6.1e-03
progressive supranuclear palsy 1.300 2.4e-02
Waldenstrons macroglobulinemia 1.013 1.8e-02

Gene RIF (2)

AA Sequence

MRMSDTVTVKDETATMKDLEAEVKDTTRVENLIKSENYGKILVEKNEHCIENNIDLQRPLQSFGQTGKRS      1 - 70
KSSSKLKLVRSLAVCEESPPPPAPEISQENQEKIQIQLTQSFEKEEKPSKDEAEKEKASDKLPRKMLSRD     71 - 140
SSQEYTDSTGIDLHEFLVNTLKNNPRDRMMLLKLEQEILDFIGNNESPRKKFPPMTSYHRMLLHRVAAYF    141 - 210
GLDHNVDQSGKSVIVNKTSNTRIPDQKFNEHIKDDKGEDFQKRYILKRDNSSFDKDDNQMRIRLKDDRRS    211 - 280
KSIEEREEEYQRARDRIFSQDSLCSQENYIIDKRLQDEDASSTQQRRQIFRVNKDASGRSTNSHQSSTEN    281 - 350
ELKYSEPRPWSSTDSDSSLRNLKPAVTKASSFSGISVLTRGDSSGSSKSIGRLSKTGSESSGSVGSSTGS    351 - 420
LSHIQQPLPGTALSQSSHGAPVVYPTVSTHSSLSFDGGLNGQVASPSTSFFLLPLEAAGIPPGSILINPQ    421 - 490
TGQPFINPDGSPVVYNPPMTQQPVRSQVPGPPQPPLPAPPQQPAANHIFSQDNLGSQFSHMSLARQPSAD    491 - 560
GSDPHAAMFQSTVVLQSPQQSGYIMTAAPPPHPPPPPPPPPPPPPLPPGQPVPTAGYPASGHPVSQPVLQ    561 - 630
QQGYIQQPSPQMPACYCAPGHYHSSQPQYRPVPSVHYNSHLNQPLPQPAQQTGYQVIPNQQQNYQGIVGV    631 - 700
QQPQSQSLVSGQPNSIGNQIQGVVIPYTSVPTYQVSLPQGSQGIPHQTYQQPVMFPNQSNQGSMPTTGMP    701 - 770
VYYSVIPPGQQNNLSSSVGYLQHPGSEQVQFPRTTSPCSSQQLQGHQCTAGPPPPPGGGMVMMQLSVPNN    771 - 840
PQSCAHSPPQWKQNKYYCDHQRGQKCVEFSSVDNIVQHSPQLSSPIISPAQSPAPAQLSTLKTVRPSGPP    841 - 910
LSIMPQFSRPFVPGQGDSRYPLLGQPLQYNPPAVLHGHIPNQQGQPGSRHGNRGRRQAKKAASTDLGAGE    911 - 980
TVVGKVLEITELPDGITRMEAEKLFGELFKIGAKIRWLRDPQSQPRRHPLCCGSGDNTANPERSKPSDLA    981 - 1050
STYTVLATFPSISAAQNALKKQINSVNKFKLRTSKKHYDFHILERASSQ                        1051 - 1099
//

Text Mined References (19)

PMID Year Title