Property Summary

NCBI Gene PubMed Count 23
Grant Count 20
R01 Count 17
Funding $1,167,455.9
PubMed Score 15.18
PubTator Score 16.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Gene RIF (15)

PMID Text
25502766 The serum lever of Alzheimer's disease were decrease and the expression of ACAP1 strongly correlated with the Mini-Mental State Examination scores of the AD patients
25496667 Genome-wide shRNA screening identifies CENTB1/ACAP1, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
25225293 ACAP1 and ARAP2 each colocalize with Arf6 but they did not colocalize with each other and have opposing effects on focal adhesions.
23317930 CENTB1 was up-regulated in patients with active UC as compared to UC remission and healthy control groups suggesting that it is involved in the inflammatory process.
22645133 phosphorylation of ACAP1 relieves a localized mechanism of autoinhibition in regulating cargo binding
22188517 the oncogenic potential of USP6 is linked to its ability to integrate cell migration and cytokinesis by regulating Arf6/ACAP1.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18003747 ACAP1 has robust, constitutive Arf6 GAP activity in vivo, with little activity toward Arf1.
17664335 Results suggest that ACAP1, a GTPase-activating protein (GAP) for ADP-ribosylation factor (ARF) 6, is part of a novel clathrin coat complex that is regulated by ARF6 for endocytic recycling in two key physiological settings.
More...

AA Sequence

MTVKLDFEECLKDSPRFRASIELVEAEVSELETRLEKLLKLGTGLLESGRHYLAASRAFVVGICDLARLG      1 - 70
PPEPMMAECLEKFTVSLNHKLDSHAELLDATQHTLQQQIQTLVKEGLRGFREARRDFWRGAESLEAALTH     71 - 140
NAEVPRRRAQEAEEAGAALRTARAGYRGRALDYALQINVIEDKRKFDIMEFVLRLVEAQATHFQQGHEEL    141 - 210
SRLSQYRKELGAQLHQLVLNSAREKRDMEQRHVLLKQKELGGEEPEPSLREGPGGLVMEGHLFKRASNAF    211 - 280
KTWSRRWFTIQSNQLVYQKKYKDPVTVVVDDLRLCTVKLCPDSERRFCFEVVSTSKSCLLQADSERLLQL    281 - 350
WVSAVQSSIASAFSQARLDDSPRGPGQGSGHLAIGSAATLGSGGMARGREPGGVGHVVAQVQSVDGNAQC    351 - 420
CDCREPAPEWASINLGVTLCIQCSGIHRSLGVHFSKVRSLTLDSWEPELVKLMCELGNVIINQIYEARVE    421 - 490
AMAVKKPGPSCSRQEKEAWIHAKYVEKKFLTKLPEIRGRRGGRGRPRGQPPVPPKPSIRPRPGSLRSKPE    491 - 560
PPSEDLGSLHPGALLFRASGHPPSLPTMADALAHGADVNWVNGGQDNATPLIQATAANSLLACEFLLQNG    561 - 630
ANVNQADSAGRGPLHHATILGHTGLACLFLKRGADLGARDSEGRDPLTIAMETANADIVTLLRLAKMREA    631 - 700
EAAQGQAGDETYLDIFRDFSLMASDDPEKLSRRSHDLHTL                                  701 - 740
//

Text Mined References (27)

PMID Year Title
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25502766 2015 Translational study of Alzheimer's disease (AD) biomarkers from brain tissues in A?PP/PS1 mice and serum of AD patients.
25284369 2014 A PH domain in ACAP1 possesses key features of the BAR domain in promoting membrane curvature.
25225293 2014 The Arf6 GTPase-activating proteins ARAP2 and ACAP1 define distinct endosomal compartments that regulate integrin ?5?1 traffic.
23317930 2013 Gene and protein expression of centaurin beta 1 (CENTB1) are up-regulated in patients with ulcerative colitis.
22645133 2012 Mechanistic insights into regulated cargo binding by ACAP1 protein.
22188517 2012 The oncogenic TBC domain protein USP6/TRE17 regulates cell migration and cytokinesis.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19946888 2010 Defining the membrane proteome of NK cells.
More...