Property Summary

NCBI Gene PubMed Count 23
PubMed Score 15.44
PubTator Score 16.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -1.200 2.6e-03
Amyotrophic lateral sclerosis -1.076 1.1e-04
Atopic dermatitis 1.200 2.7e-03
atypical teratoid/rhabdoid tumor -1.100 3.6e-04
autosomal dominant Emery-Dreifuss muscul... -1.043 2.5e-02
cutaneous lupus erythematosus 1.300 9.8e-03
glioblastoma -1.200 2.1e-04
group 4 medulloblastoma -1.400 8.7e-04
interstitial cystitis 1.900 1.3e-03
juvenile dermatomyositis -1.123 6.8e-09
medulloblastoma, large-cell -1.500 3.0e-04
osteosarcoma -3.683 8.8e-10
tuberculosis 1.200 1.2e-05

Gene RIF (15)

AA Sequence

MTVKLDFEECLKDSPRFRASIELVEAEVSELETRLEKLLKLGTGLLESGRHYLAASRAFVVGICDLARLG      1 - 70
PPEPMMAECLEKFTVSLNHKLDSHAELLDATQHTLQQQIQTLVKEGLRGFREARRDFWRGAESLEAALTH     71 - 140
NAEVPRRRAQEAEEAGAALRTARAGYRGRALDYALQINVIEDKRKFDIMEFVLRLVEAQATHFQQGHEEL    141 - 210
SRLSQYRKELGAQLHQLVLNSAREKRDMEQRHVLLKQKELGGEEPEPSLREGPGGLVMEGHLFKRASNAF    211 - 280
KTWSRRWFTIQSNQLVYQKKYKDPVTVVVDDLRLCTVKLCPDSERRFCFEVVSTSKSCLLQADSERLLQL    281 - 350
WVSAVQSSIASAFSQARLDDSPRGPGQGSGHLAIGSAATLGSGGMARGREPGGVGHVVAQVQSVDGNAQC    351 - 420
CDCREPAPEWASINLGVTLCIQCSGIHRSLGVHFSKVRSLTLDSWEPELVKLMCELGNVIINQIYEARVE    421 - 490
AMAVKKPGPSCSRQEKEAWIHAKYVEKKFLTKLPEIRGRRGGRGRPRGQPPVPPKPSIRPRPGSLRSKPE    491 - 560
PPSEDLGSLHPGALLFRASGHPPSLPTMADALAHGADVNWVNGGQDNATPLIQATAANSLLACEFLLQNG    561 - 630
ANVNQADSAGRGPLHHATILGHTGLACLFLKRGADLGARDSEGRDPLTIAMETANADIVTLLRLAKMREA    631 - 700
EAAQGQAGDETYLDIFRDFSLMASDDPEKLSRRSHDLHTL                                  701 - 740
//

Text Mined References (27)

PMID Year Title