Property Summary

NCBI Gene PubMed Count 85
Grant Count 46
R01 Count 34
Funding $3,146,766.43
PubMed Score 64.51
PubTator Score 201.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Rheumatoid Arthritis 1.400 0.008
osteosarcoma -2.679 0.000
astrocytoma 1.200 0.010
medulloblastoma, large-cell 1.100 0.001
tuberculosis -1.400 0.000
lung cancer -1.200 0.018
breast carcinoma -1.100 0.000
fibroadenoma -1.100 0.034
spina bifida -1.422 0.036
ductal carcinoma in situ -1.100 0.001
invasive ductal carcinoma -1.400 0.003
ovarian cancer 2.000 0.000

Gene RIF (62)

PMID Text
26738398 Data suggest that tumour necrosis factor alpha-induced protein 3 (TNFAIP3) and TNFAIP3-interacting protein 1 (TNIP1) single nucleotide polymorphisms (SNPs) confer increased risk of psoriasis in ethnic South Indian Tamils.
26733199 HIV-1 depends on host-cell-encoded factors to complete its life cycle; data suggest that nucleus-located NAF1/TNIP1 promotes nuclear export of un-spliced HIV-1 gag mRNA; association between NAF1/TNIP1 and CRM1 is required for this function.
26382585 Hepatitis C virus antigen stimulation up-regulates A20/A20-binding inhibitor of NF-kappaB binding protein expression, which consequently contributes to inefficient M1 macrophage polarization.
25631139 Since TNIP1 may facilitate the function of TNFAIP3 in the negative feedback regulation of NF-kappaB activation [5], the corresponding transcript levels of TNIP1 in psoriasis vul- garis were investigated in this study.
25447897 HSPA6 regulation by TNIP1 occurs in promoter regions lacking binding sites for known TNIP1-repressed transcription factors
25264125 The aim of this study was to investigate whether the HCP5, TNIP1, TNFAIP3, SPATA2 and COG6 genes were genetic risk factors for psoriasis in Chinese population.
25034154 Single-nucleotide polymorphisms rs7708392 and rs495881 in TNIP1 were significantly associated with Lupus Nephritis in individuals with European or African ancestry.
24788730 TNIP1 polymorphism may be a risk factor for VKH syndrome in Han Chinese
24091983 Report role of TNIP1 genetic variants in confering risk of systemic lupus erythematosus in Chinese population.
23970121 variants in the TNIP1 gene are associated with the risk for lupus nephritis and could be mechanistically involved in disease development via aberrant regulation of NF-kappaB and mitogen-activated protein kinase activity.
More...

AA Sequence

MEGRGPYRIYDPGGSVPSGEASAAFERLVKENSRLKEKMQGIKMLGELLEESQMEATRLRQKAEELVKDN      1 - 70
ELLPPPSPSLGSFDPLAELTGKDSNVTASPTAPACPSDKPAPVQKPPSSGTSSEFEVVTPEEQNSPESSS     71 - 140
HANAMALGPLPREDGNLMLHLQRLETTLSVCAEEPDHGQLFTHLGRMALEFNRLASKVHKNEQRTSILQT    141 - 210
LCEQLRKENEALKAKLDKGLEQRDQAAERLREENLELKKLLMSNGNKEGASGRPGSPKMEGTGKKAVAGQ    211 - 280
QQASVTAGKVPEVVALGAAEKKVKMLEQQRSELLEVNKQWDQHFRSMKQQYEQKITELRQKLADLQKQVT    281 - 350
DLEAEREQKQRDFDRKLLLAKSKIEMEETDKEQLTAEAKELRQKVKYLQDQLSPLTRQREYQEKEIQRLN    351 - 420
KALEEALSIQTPPSSPPTAFGSPEGAGALLRKQELVTQNELLKQQVKIFEEDFQRERSDRERMNEEKEEL    421 - 490
KKQVEKLQAQVTLSNAQLKAFKDEEKAREALRQQKRKAKASGERYHVEPHPEHLCGAYPYAYPPMPAMVP    491 - 560
HHGFEDWSQIRYPPPPMAMEHPPPLPNSRLFHLPEYTWRLPCGGVRNPNQSSQVMDPPTARPTEPESPKN    561 - 630
DREGPQ                                                                    631 - 636
//

Text Mined References (95)

PMID Year Title
26738398 2015 TNFAIP3 and TNIP1 polymorphisms confer psoriasis risk in South Indian Tamils.
26733199 2016 HIV-1 Nef-associated Factor 1 Enhances Viral Production by Interacting with CRM1 to Promote Nuclear Export of Unspliced HIV-1 gag mRNA.
26382585 2015 Up-regulation of A20/ABIN1 contributes to inefficient M1 macrophage polarization during Hepatitis C virus infection.
25631139 2015 Upregulation of tumor necrosis factor alpha-induced protein 3 interacting protein 1 mRNA in psoriasis vulgaris.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25447897 2015 TNIP1 reduction of HSPA6 gene expression occurs in promoter regions lacking binding sites for known TNIP1-repressed transcription factors.
25416956 2014 A proteome-scale map of the human interactome network.
25264125 2014 Investigating the genetic association of HCP5, SPATA2, TNIP1, TNFAIP3 and COG6 with psoriasis in Chinese population.
25034154 2014 Clinical perspectives on lupus genetics: advances and opportunities.
24788730 2014 Association of a TNIP1 polymorphism with Vogt-Koyanagi-Harada syndrome but not with ocular Behcet's disease in Han Chinese.
More...