Property Summary

NCBI Gene PubMed Count 97
PubMed Score 70.52
PubTator Score 201.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytoma 1.200 9.5e-03
breast carcinoma -1.100 2.8e-04
ductal carcinoma in situ -1.100 7.0e-04
fibroadenoma -1.100 3.4e-02
invasive ductal carcinoma -1.400 2.9e-03
lung cancer -1.100 3.9e-03
medulloblastoma, large-cell 1.100 8.9e-04
osteosarcoma -2.679 1.1e-05
ovarian cancer 2.000 2.0e-06
Rheumatoid arthritis 1.400 7.9e-03
spina bifida -1.422 3.6e-02
tuberculosis -1.400 1.3e-07

Protein-protein Interaction (3)

Gene RIF (70)

AA Sequence

MEGRGPYRIYDPGGSVPSGEASAAFERLVKENSRLKEKMQGIKMLGELLEESQMEATRLRQKAEELVKDN      1 - 70
ELLPPPSPSLGSFDPLAELTGKDSNVTASPTAPACPSDKPAPVQKPPSSGTSSEFEVVTPEEQNSPESSS     71 - 140
HANAMALGPLPREDGNLMLHLQRLETTLSVCAEEPDHGQLFTHLGRMALEFNRLASKVHKNEQRTSILQT    141 - 210
LCEQLRKENEALKAKLDKGLEQRDQAAERLREENLELKKLLMSNGNKEGASGRPGSPKMEGTGKKAVAGQ    211 - 280
QQASVTAGKVPEVVALGAAEKKVKMLEQQRSELLEVNKQWDQHFRSMKQQYEQKITELRQKLADLQKQVT    281 - 350
DLEAEREQKQRDFDRKLLLAKSKIEMEETDKEQLTAEAKELRQKVKYLQDQLSPLTRQREYQEKEIQRLN    351 - 420
KALEEALSIQTPPSSPPTAFGSPEGAGALLRKQELVTQNELLKQQVKIFEEDFQRERSDRERMNEEKEEL    421 - 490
KKQVEKLQAQVTLSNAQLKAFKDEEKAREALRQQKRKAKASGERYHVEPHPEHLCGAYPYAYPPMPAMVP    491 - 560
HHGFEDWSQIRYPPPPMAMEHPPPLPNSRLFHLPEYTWRLPCGGVRNPNQSSQVMDPPTARPTEPESPKN    561 - 630
DREGPQ                                                                    631 - 636
//

Text Mined References (107)

PMID Year Title