Property Summary

NCBI Gene PubMed Count 72
Grant Count 67
R01 Count 44
Funding $5,140,511.28
PubMed Score 97.38
PubTator Score 96.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Multiple myeloma 1.295 0.006
astrocytic glioma 1.500 0.009
ependymoma 1.700 0.008
oligodendroglioma 1.900 0.002
osteosarcoma 2.068 0.000
cystic fibrosis 1.072 0.000
acute quadriplegic myopathy 1.115 0.000
intraductal papillary-mucinous carcinoma... 1.100 0.032
lung cancer 1.800 0.004
Breast cancer 2.400 0.027
group 3 medulloblastoma 1.300 0.001
Pick disease 1.600 0.000
progressive supranuclear palsy 1.100 0.022
ovarian cancer -1.200 0.000
dermatomyositis 1.300 0.000

Synonym

Accession Q15022 Q96BD9
Symbols CHET9
JJAZ1

Gene

PANTHER Protein Class (1)

PDB

5HYN   5IJ7   5IJ8  

Gene RIF (46)

PMID Text
26837964 The difference in the SUZ12 and CBX8 genes expression were significantly divergent between tumors and their marginal tissues.
26457648 Data show that RAS protein activation was the initiating oncogenic event, with polycomb repressive complex 2 (PRC2) subunits impairment being a secondary event.
26407907 SUZ12 is a key molecule in the regulation of monoallelic expression of IGF2.
26268246 Activation of EZH2 and SUZ12 Regulated by E2F1 Predicts the Disease Progression and Aggressive Characteristics of Bladder Cancer
26176059 Conclude that the expression of SUZ12 is increased along with the degree of infiltration and metastasis of gastric carcinoma.
25855382 downregulation of SUZ12 and ZNF198 leads to epigenetic reprogramming of infected hepatocytes. Because both Plk1 and HOTAIR are elevated in many human cancers, we propose that their combined effects are involved in epigenetic reprogramming
25833694 this study described that miR-489 expression level was significantly reduced in lung cancer samples (n = 115) and cell lines. Abnormal expression of miR-489 regulated the cells invasion by binding SUZ12 3'-UTR in vitro.
25672609 Upregulation of SUZ12 was found to play a key role in gastric cancer cell proliferation and metastasis through the regulation of EMT and KLF2 expression
25326896 Data show that overall enhancer of zeste 2 (EZH2), embryonic ectoderm development (EED) and suppressor of zeste 12 homolog (SUZ12) expression in the colorectal cancer (CRC) tissues was significantly increased than in the non-cancerous tissue.
25305755 Somatic mutations of SUZ12 have a central role in malignant transformation of peripheral nerve sheath tumors.
More...

AA Sequence

MAPQKHGGGGGGGSGPSAGSGGGGFGGSAAVAAATASGGKSGGGSCGGGGSYSASSSSSAAAAAGAAVLP      1 - 70
VKKPKMEHVQADHELFLQAFEKPTQIYRFLRTRNLIAPIFLHRTLTYMSHRNSRTNIKRKTFKVDDMLSK     71 - 140
VEKMKGEQESHSLSAHLQLTFTGFFHKNDKPSPNSENEQNSVTLEVLLVKVCHKKRKDVSCPIRQVPTGK    141 - 210
KQVPLNPDLNQTKPGNFPSLAVSSNEFEPSNSHMVKSYSLLFRVTRPGRREFNGMINGETNENIDVNEEL    211 - 280
PARRKRNREDGEKTFVAQMTVFDKNRRLQLLDGEYEVAMQEMEECPISKKRATWETILDGKRLPPFETFS    281 - 350
QGPTLQFTLRWTGETNDKSTAPIAKPLATRNSESLHQENKPGSVKPTQTIAVKESLTTDLQTRKEKDTPN    351 - 420
ENRQKLRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRKLYSLLKHLKLCHSRFIFNYVYHPKGARIDVS    421 - 490
INECYDGSYAGNPQDIHRQPGFAFSRNGPVKRTPITHILVCRPKRTKASMSEFLESEDGEVEQQRTYSSG    491 - 560
HNRLYFHSDTCLPLRPQEMEVDSEDEKDPEWLREKTITQIEEFSDVNEGEKEVMKLWNLHVMKHGFIADN    561 - 630
QMNHACMLFVENYGQKIIKKNLCRNFMLHLVSMHDFNLISIMSIDKAVTKLREMQQKLEKGESASPANEE    631 - 700
ITEEQNGTANGFSEINSKEKALETDSVSGVSKQSKKQKL                                   701 - 739
//

Text Mined References (91)

PMID Year Title
26837964 Evaluating of suppressor of zeste 12 and chromobox homolog 8 genes expression showed two possible origins for gastric cancer development.
26457648 2015 Juvenile myelomonocytic leukemia displays mutations in components of the RAS pathway and the PRC2 network.
26407907 2015 Restoration of IGF2 imprinting by polycomb repressive complex 2 docking factor SUZ12 in colon cancer cells.
26268246 2015 Activation of EZH2 and SUZ12 Regulated by E2F1 Predicts the Disease Progression and Aggressive Characteristics of Bladder Cancer.
26176059 2014 SUZ12 RNA Interference Inhibits the Invasion of Gastric Carcinoma Cells.
25855382 2015 PLK1 and HOTAIR Accelerate Proteasomal Degradation of SUZ12 and ZNF198 during Hepatitis B Virus-Induced Liver Carcinogenesis.
25833694 2015 Down-regulation of miR-489 contributes into NSCLC cell invasion through targeting SUZ12.
25672609 2015 SUZ12 promotes gastric cancer cell proliferation and metastasis by regulating KLF2 and E-cadherin.
25326896 2015 Expression and clinicopathological significance of EED, SUZ12 and EZH2 mRNA in colorectal cancer.
25305755 2014 Somatic mutations of SUZ12 in malignant peripheral nerve sheath tumors.
More...