Property Summary

NCBI Gene PubMed Count 88
PubMed Score 107.65
PubTator Score 96.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
acute quadriplegic myopathy 1.115 3.7e-06
astrocytic glioma 1.500 8.7e-03
Breast cancer 2.400 2.7e-02
cystic fibrosis 1.072 2.0e-05
dermatomyositis 1.300 2.2e-04
ependymoma 1.700 8.3e-03
group 3 medulloblastoma 1.300 5.3e-04
intraductal papillary-mucinous carcinoma... 1.100 3.2e-02
lung cancer 1.800 3.9e-03
Multiple myeloma 1.295 5.8e-03
oligodendroglioma 1.900 2.3e-03
osteosarcoma 2.068 2.5e-05
ovarian cancer -1.200 2.5e-04
Pick disease 1.600 2.0e-04
progressive supranuclear palsy 1.100 2.2e-02

Protein-protein Interaction (12)

Gene RIF (51)

AA Sequence

MAPQKHGGGGGGGSGPSAGSGGGGFGGSAAVAAATASGGKSGGGSCGGGGSYSASSSSSAAAAAGAAVLP      1 - 70
VKKPKMEHVQADHELFLQAFEKPTQIYRFLRTRNLIAPIFLHRTLTYMSHRNSRTNIKRKTFKVDDMLSK     71 - 140
VEKMKGEQESHSLSAHLQLTFTGFFHKNDKPSPNSENEQNSVTLEVLLVKVCHKKRKDVSCPIRQVPTGK    141 - 210
KQVPLNPDLNQTKPGNFPSLAVSSNEFEPSNSHMVKSYSLLFRVTRPGRREFNGMINGETNENIDVNEEL    211 - 280
PARRKRNREDGEKTFVAQMTVFDKNRRLQLLDGEYEVAMQEMEECPISKKRATWETILDGKRLPPFETFS    281 - 350
QGPTLQFTLRWTGETNDKSTAPIAKPLATRNSESLHQENKPGSVKPTQTIAVKESLTTDLQTRKEKDTPN    351 - 420
ENRQKLRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRKLYSLLKHLKLCHSRFIFNYVYHPKGARIDVS    421 - 490
INECYDGSYAGNPQDIHRQPGFAFSRNGPVKRTPITHILVCRPKRTKASMSEFLESEDGEVEQQRTYSSG    491 - 560
HNRLYFHSDTCLPLRPQEMEVDSEDEKDPEWLREKTITQIEEFSDVNEGEKEVMKLWNLHVMKHGFIADN    561 - 630
QMNHACMLFVENYGQKIIKKNLCRNFMLHLVSMHDFNLISIMSIDKAVTKLREMQQKLEKGESASPANEE    631 - 700
ITEEQNGTANGFSEINSKEKALETDSVSGVSKQSKKQKL                                   701 - 739
//

Text Mined References (108)

PMID Year Title