Property Summary

NCBI Gene PubMed Count 49
PubMed Score 38.12
PubTator Score 113.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
acute myeloid leukemia 1.400 3.4e-02
adrenocortical carcinoma 1.158 1.4e-03
adult high grade glioma -1.200 4.0e-03
astrocytoma 1.100 1.9e-02
dermatomyositis 1.100 1.2e-03
diabetes mellitus 1.200 2.3e-03
group 3 medulloblastoma 1.200 1.0e-02
juvenile dermatomyositis 1.142 5.9e-09
lung adenocarcinoma -1.100 9.2e-06
lung cancer 1.100 4.6e-03
malignant mesothelioma 2.100 7.8e-08
medulloblastoma, large-cell 1.200 1.7e-05
osteosarcoma -1.143 4.5e-04
ovarian cancer -1.200 2.1e-03
Subcutaneous panniculitis-like T-cell ly... 1.500 1.1e-02
tuberculosis -1.100 5.2e-05

Gene RIF (22)

AA Sequence

MATAAETSASEPEAESKAGPKADGEEDEVKAARTRRKVLSRAVAAATYKTMGPAWDQQEEGVSESDGDEY      1 - 70
AMASSAESSPGEYEWEYDEEEEKNQLEIERLEEQLSINVYDYNCHVDLIRLLRLEGELTKVRMARQKMSE     71 - 140
IFPLTEELWLEWLHDEISMAQDGLDREHVYDLFEKAVKDYICPNIWLEYGQYSVGGIGQKGGLEKVRSVF    141 - 210
ERALSSVGLHMTKGLALWEAYREFESAIVEAARLEKVHSLFRRQLAIPLYDMEATFAEYEEWSEDPIPES    211 - 280
VIQNYNKALQQLEKYKPYEEALLQAEAPRLAEYQAYIDFEMKIGDPARIQLIFERALVENCLVPDLWIRY    281 - 350
SQYLDRQLKVKDLVLSVHNRAIRNCPWTVALWSRYLLAMERHGVDHQVISVTFEKALNAGFIQATDYVEI    351 - 420
WQAYLDYLRRRVDFKQDSSKELEELRAAFTRALEYLKQEVEERFNESGDPSCVIMQNWARIEARLCNNMQ    421 - 490
KARELWDSIMTRGNAKYANMWLEYYNLERAHGDTQHCRKALHRAVQCTSDYPEHVCEVLLTMERTEGSLE    491 - 560
DWDIAVQKTETRLARVNEQRMKAAEKEAALVQQEEEKAEQRKRARAEKKALKKKKKIRGPEKRGADEDDE    561 - 630
KEWGDDEEEQPSKRRRVENSIPAAGETQNVEVAAGPAGKCAAVDVEPPSKQKEKAASLKRDMPKVLHDSS    631 - 700
KDSITVFVSNLPYSMQEPDTKLRPLFEACGEVVQIRPIFSNRGDFRGYCYVEFKEEKSALQALEMDRKSV    701 - 770
EGRPMFVSPCVDKSKNPDFKVFRYSTSLEKHKLFISGLPFSCTKEELEEICKAHGTVKDLRLVTNRAGKP    771 - 840
KGLAYVEYENESQASQAVMKMDGMTIKENIIKVAISNPPQRKVPEKPETRKAPGGPMLLPQTYGARGKGR    841 - 910
TQLSLLPRALQRPSAAAPQAENGPAAAPAVAAPAATEAPKMSNADFAKLFLRK                     911 - 963
//

Text Mined References (62)

PMID Year Title