Property Summary

NCBI Gene PubMed Count 42
PubMed Score 36.36
PubTator Score 113.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
juvenile dermatomyositis 1189 5.94173792885478E-9
malignant mesothelioma 3163 7.83405996019936E-8
ovarian cancer 8492 7.39623160039731E-6
lung adenocarcinoma 2714 9.15270623070261E-6
medulloblastoma, large-cell 6234 1.70067733244388E-5
tuberculosis 1563 5.21283604856915E-5
osteosarcoma 7933 4.54522535276377E-4
dermatomyositis 967 0.00116160324358962
adrenocortical carcinoma 1427 0.00136810026984716
diabetes mellitus 1663 0.00152684550132057
adult high grade glioma 2148 0.00398013287641877
lung cancer 4473 0.00455012061936754
group 3 medulloblastoma 2254 0.0103036145678029
Subcutaneous panniculitis-like T-cell lymphoma 16 0.0109010123563767
astrocytoma 1493 0.0185202690248323
acute myeloid leukemia 785 0.0469805126098433
Disease Target Count Z-score Confidence
Keratosis 34 3.658 1.8

Expression

  Differential Expression (16)

Disease log2 FC p
malignant mesothelioma 2.100 0.000
osteosarcoma -1.143 0.000
astrocytoma 1.100 0.019
medulloblastoma, large-cell 1.200 0.000
juvenile dermatomyositis 1.142 0.000
adrenocortical carcinoma 1.158 0.001
tuberculosis -1.100 0.000
lung cancer 1.100 0.005
diabetes mellitus 2.900 0.002
lung adenocarcinoma -1.100 0.000
adult high grade glioma -1.200 0.004
group 3 medulloblastoma 1.200 0.010
Subcutaneous panniculitis-like T-cell ly... 1.500 0.011
acute myeloid leukemia 3.100 0.047
ovarian cancer 2.400 0.000
dermatomyositis 1.100 0.001

Synonym

Accession Q15020 A8K2E4 B7ZKM0 Q2M2H0 Q58F06 Q8IUS1 Q96J95 SART-3
Symbols P100
p110
DSAP1
TIP110
p110(nrb)
RP11-13G14

Gene

PANTHER Protein Class (2)

PDB

5JJW   2DO4   5CTQ   5CTR   5CTT   5JJX   5JPZ  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
C. elegans OMA EggNOG
Fruitfly EggNOG Inparanoid

Pathway (1)

Gene RIF (18)

PMID Text
25939381 Hypoxia led to Tip110 protein degradation through the ubiquitin-proteasome system. Under hypoxia, Tip110 stabilized p53, which in return destabilized Tip110.
25928721 miR-124 regulates Tip110 expression and differentiation of human cord blood CD34(+) cells
24526689 SART3 recruits ubH2B, which may be evicted from DNA during transcription, for deubiquitination by Usp15
24316072 HIV-1 Tat complexes with LARP7, MEPCE, SART3, NPM1, PPM1G, hnRNP-F, and 7SK RNA to form a Tat-7SK RNP complex to control HIV-1 transcription
24217245 these findings have provided additional and mechanistic evidence to support Tip110 function in HIV-1 transcription.
24217245 HIV-1 Tat complexes with LARP7, MEPCE, SART3, NPM1, PPM1G, hnRNP-F, and 7SK RNA to form a Tat-7SK RNP complex to control HIV-1 transcription
23834120 Results identify a novel frameshift mutation in this gene implicated in disseminated superficial actinic porokeratosis in 4 Chinese families
23822148 YB-1 potentiates the Tip110/Tat-mediated transactivation of the HIV-1 LTR promoter.
23088399 findings show C-MYC upregulates transcription of TIP110 through interaction with the TIP110 E-box in the TIP110 promoter, ensuring high-level Tip110 expression in proliferating embryonic stem cells (hESCs); further show TIP110 regulates OCT4 alternative splicing in hESCs
22132941 TIP110 is also expressed in human embryonic stem cells (hESCs) and expression was decreased with differentiation of these ESCs.
More...

AA Sequence

MATAAETSASEPEAESKAGPKADGEEDEVKAARTRRKVLSRAVAAATYKTMGPAWDQQEEGVSESDGDEY      1 - 70
AMASSAESSPGEYEWEYDEEEEKNQLEIERLEEQLSINVYDYNCHVDLIRLLRLEGELTKVRMARQKMSE     71 - 140
IFPLTEELWLEWLHDEISMAQDGLDREHVYDLFEKAVKDYICPNIWLEYGQYSVGGIGQKGGLEKVRSVF    141 - 210
ERALSSVGLHMTKGLALWEAYREFESAIVEAARLEKVHSLFRRQLAIPLYDMEATFAEYEEWSEDPIPES    211 - 280
VIQNYNKALQQLEKYKPYEEALLQAEAPRLAEYQAYIDFEMKIGDPARIQLIFERALVENCLVPDLWIRY    281 - 350
SQYLDRQLKVKDLVLSVHNRAIRNCPWTVALWSRYLLAMERHGVDHQVISVTFEKALNAGFIQATDYVEI    351 - 420
WQAYLDYLRRRVDFKQDSSKELEELRAAFTRALEYLKQEVEERFNESGDPSCVIMQNWARIEARLCNNMQ    421 - 490
KARELWDSIMTRGNAKYANMWLEYYNLERAHGDTQHCRKALHRAVQCTSDYPEHVCEVLLTMERTEGSLE    491 - 560
DWDIAVQKTETRLARVNEQRMKAAEKEAALVQQEEEKAEQRKRARAEKKALKKKKKIRGPEKRGADEDDE    561 - 630
KEWGDDEEEQPSKRRRVENSIPAAGETQNVEVAAGPAGKCAAVDVEPPSKQKEKAASLKRDMPKVLHDSS    631 - 700
KDSITVFVSNLPYSMQEPDTKLRPLFEACGEVVQIRPIFSNRGDFRGYCYVEFKEEKSALQALEMDRKSV    701 - 770
EGRPMFVSPCVDKSKNPDFKVFRYSTSLEKHKLFISGLPFSCTKEELEEICKAHGTVKDLRLVTNRAGKP    771 - 840
KGLAYVEYENESQASQAVMKMDGMTIKENIIKVAISNPPQRKVPEKPETRKAPGGPMLLPQTYGARGKGR    841 - 910
TQLSLLPRALQRPSAAAPQAENGPAAAPAVAAPAATEAPKMSNADFAKLFLRK                     911 - 963
//

Text Mined References (55)

PMID Year Title
25939381 2015 Tip110 Regulates the Cross Talk between p53 and Hypoxia-Inducible Factor 1? under Hypoxia and Promotes Survival of Cancer Cells.
25928721 2015 MicroRNA-124 Targets Tip110 Expression and Regulates Hematopoiesis.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24526689 2014 The U4/U6 recycling factor SART3 has histone chaperone activity and associates with USP15 to regulate H2B deubiquitination.
24217245 2014 Tip110 protein binds to unphosphorylated RNA polymerase II and promotes its phosphorylation and HIV-1 long terminal repeat transcription.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23834120 2013 Identification of three novel frameshift mutations of the MVK gene in four Chinese families with disseminated superficial actinic porokeratosis.
23822148 2013 Tip110 interacts with YB-1 and regulates each other's function.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23088399 2013 C-MYC controlled TIP110 protein expression regulates OCT4 mRNA splicing in human embryonic stem cells.
More...