Property Summary

NCBI Gene PubMed Count 75
PubMed Score 191.95
PubTator Score 55.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
adult high grade glioma 1.300 1.1e-02
Alzheimer's disease -1.100 3.9e-02
astrocytic glioma 1.400 2.4e-02
Astrocytoma, Pilocytic 1.100 1.3e-03
atypical teratoid / rhabdoid tumor 1.500 1.2e-04
diabetes mellitus -1.700 1.0e-02
Down syndrome 1.400 1.3e-03
ependymoma 1.900 2.9e-02
glioblastoma 1.100 7.3e-05
hereditary spastic paraplegia -1.295 3.8e-03
lung adenocarcinoma 1.555 6.7e-11
medulloblastoma 1.300 2.3e-02
medulloblastoma, large-cell 1.400 4.4e-06
Multiple myeloma 1.245 7.8e-03
non diabetic and post-ischemic heart fai... -1.200 1.7e-02
oligodendroglioma 2.000 1.3e-02
osteosarcoma 2.007 9.2e-06
ovarian cancer -1.500 6.3e-10
pancreatic ductal adenocarcinoma liver m... 1.146 3.5e-02
primitive neuroectodermal tumor 1.100 1.6e-05
progressive supranuclear palsy -1.200 4.6e-03
psoriasis 1.200 1.2e-03
Rheumatoid arthritis 1.400 3.5e-02
Subcutaneous panniculitis-like T-cell ly... -1.200 3.8e-02

Protein-protein Interaction (10)

Gene RIF (32)

AA Sequence

MSKQQPTQFINPETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGKSTLINSLFLTDLYPERVIPG      1 - 70
AAEKIERTVQIEASTVEIEERGVKLRLTVVDTPGYGDAINCRDCFKTIISYIDEQFERYLHDESGLNRRH     71 - 140
IIDNRVHCCFYFISPFGHGLKPLDVAFMKAIHNKVNIVPVIAKADTLTLKERERLKKRILDEIEEHNIKI    141 - 210
YHLPDAESDEDEDFKEQTRLLKASIPFSVVGSNQLIEAKGKKVRGRLYPWGVVEVENPEHNDFLKLRTML    211 - 280
ITHMQDLQEVTQDLHYENFRSERLKRGGRKVENEDMNKDQILLEKEAELRRMQEMIARMQAQMQMQMQGG    281 - 350
DGDGGALGHHV                                                               351 - 361
//

Text Mined References (94)

PMID Year Title