Property Summary

NCBI Gene PubMed Count 63
Grant Count 30
R01 Count 5
Funding $19,372,433.51
PubMed Score 175.29
PubTator Score 55.68

Knowledge Summary

Patent

No data available

Expression

Gene RIF (29)

PMID Text
26780475 From the nucleotide-free structure some interesting conclusions about the nucleotide binding properties of Cdc11 can be drawn; especially when aligning the structure with the structure of GDP bound Sept2
26000982 These results suggest that SEPTIN2-mediated cytoskeletal rearrangement and STATHMIN-mediated differentiation may contribute to changes in cell morphology and differentiation of H/RS cells with CD99 upregulation in Hodgkin lymphoma.
25592041 Suggest PPAR-gamma activation down-regulates hepatocellular carcinoma cell SEPT2 levels to prevent tumor growth.
25293760 Authors report here that the septins SEPT2, -9, -11, and probably -7 form fibrillar structures around the chlamydial inclusion.
24787956 Data indicate that forchlorfenuron (FCF) exhibits differential binding preference for septins SEPT2 and SEPT3.
23572511 SEPT2 forms a 1:1:1 complex with SEPT7 and SEPT9.
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
21967827 The results shown in study support the hypothesis that single Septin 2, when present in excess or with unbalanced stoichiometries, may be unstable and assemble into amyloid-like structures.
21788367 The SEPT2 provides the directional guidance cues necessary for polarizing the epithelial microtubule network.
21767235 Data illustrated roles of SEPT9 that might contribute to hetero-trimeric septin complex formation. SEPT9 can substitute for septins of the SEPT2 group and partially for SEPT7.
More...

AA Sequence

MSKQQPTQFINPETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGKSTLINSLFLTDLYPERVIPG      1 - 70
AAEKIERTVQIEASTVEIEERGVKLRLTVVDTPGYGDAINCRDCFKTIISYIDEQFERYLHDESGLNRRH     71 - 140
IIDNRVHCCFYFISPFGHGLKPLDVAFMKAIHNKVNIVPVIAKADTLTLKERERLKKRILDEIEEHNIKI    141 - 210
YHLPDAESDEDEDFKEQTRLLKASIPFSVVGSNQLIEAKGKKVRGRLYPWGVVEVENPEHNDFLKLRTML    211 - 280
ITHMQDLQEVTQDLHYENFRSERLKRGGRKVENEDMNKDQILLEKEAELRRMQEMIARMQAQMQMQMQGG    281 - 350
DGDGGALGHHV                                                               351 - 361
//

Text Mined References (83)

PMID Year Title
26780475 2016 Crystal structure of Cdc11, a septin subunit from Saccharomyces cerevisiae.
26000982 2015 SEPTIN2 and STATHMIN Regulate CD99-Mediated Cellular Differentiation in Hodgkin's Lymphoma.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25592041 2015 Activation of peroxisome proliferator-activated receptor-? (PPAR?) inhibits hepatoma cell growth via downregulation of SEPT2 expression.
25588830 2015 SEPT12 orchestrates the formation of mammalian sperm annulus by organizing core octameric complexes with other SEPT proteins.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
25293760 2014 Septins arrange F-actin-containing fibers on the Chlamydia trachomatis inclusion and are required for normal release of the inclusion by extrusion.
24787956 2014 In silico docking of forchlorfenuron (FCF) to septins suggests that FCF interferes with GTP binding.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...