Property Summary

NCBI Gene PubMed Count 16
Grant Count 1
R01 Count 1
Funding $49,598.89
PubMed Score 2.80
PubTator Score 3.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.300 0.000

Synonym

Accession Q15018 B4DKR2 Q96H11
Symbols ABRO1
KIAA0157

Gene

 Grant Application (1)

Gene RIF (3)

PMID Text
26344097 KIAA0157 allosterically activates a cognate deubiquitinating enzyme (DUB) partner and implicates super dimerization as a new regulatory mechanism underlying BRCC36 DUB activity.
25283148 ABRO1 is a novel p53 regulator that plays an important role in tumor suppression and the DNA damage response
21195082 Study identified Abro1 as a specific interactor of THAP5, a zinc finger transcription factor that is involved in G2/M control and apoptosis.

AA Sequence

MAASISGYTFSAVCFHSANSNADHEGFLLGEVRQEETFSISDSQISNTEFLQVIEIHNHQPCSKLFSFYD      1 - 70
YASKVNEESLDRILKDRRKKVIGWYRFRRNTQQQMSYREQVLHKQLTRILGVPDLVFLLFSFISTANNST     71 - 140
HALEYVLFRPNRRYNQRISLAIPNLGNTSQQEYKVSSVPNTSQSYAKVIKEHGTDFFDKDGVMKDIRAIY    141 - 210
QVYNALQEKVQAVCADVEKSERVVESCQAEVNKLRRQITQRKNEKEQERRLQQAVLSRQMPSESLDPAFS    211 - 280
PRMPSSGFAAEGRSTLGDAEASDPPPPYSDFHPNNQESTLSHSRMERSVFMPRPQAVGSSNYASTSAGLK    281 - 350
YPGSGADLPPPQRAAGDSGEDSDDSDYENLIDPTEPSNSEYSHSKDSRPMAHPDEDPRNTQTSQI         351 - 415
//

Text Mined References (28)

PMID Year Title
26344097 2015 Higher-Order Assembly of BRCC36-KIAA0157 Is Required for DUB Activity and Biological Function.
26195665 2015 The deubiquitinating enzyme complex BRISC is required for proper mitotic spindle assembly in mammalian cells.
25283148 2014 ABRO1 suppresses tumourigenesis and regulates the DNA damage response by stabilizing p53.
24075985 2013 A BRISC-SHMT complex deubiquitinates IFNAR1 and regulates interferon responses.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22974638 2012 ATF4 interacts with Abro1/KIAA0157 scaffold protein and participates in a cytoprotective pathway.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21282113 2011 NBA1/MERIT40 and BRE interaction is required for the integrity of two distinct deubiquitinating enzyme BRCC36-containing complexes.
21269460 2011 Initial characterization of the human central proteome.
21195082 2011 Regulation of Abro1/KIAA0157 during myocardial infarction and cell death reveals a novel cardioprotective mechanism for Lys63-specific deubiquitination.
More...