Property Summary

NCBI Gene PubMed Count 22
PubMed Score 8.10
PubTator Score 5.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adrenocortical carcinoma 1.350 5.4e-03
ependymoma 1.200 3.8e-02
hepatocellular carcinoma -1.700 1.8e-03
intraductal papillary-mucinous adenoma (... 1.100 3.0e-02
oligodendroglioma 1.100 1.8e-02
osteosarcoma 1.786 2.3e-05
ovarian cancer -1.500 4.5e-05
Pick disease 1.600 1.7e-03
pituitary cancer -1.100 2.4e-03
primitive neuroectodermal tumor 1.200 7.2e-04
psoriasis -1.100 9.1e-07
Rheumatoid arthritis 1.500 1.6e-02

Gene RIF (3)

AA Sequence

MSSRKQGSQPRGQQSAEEENFKKPTRSNMQRSKMRGASSGKKTAGPQQKNLEPALPGRWGGRSAENPPSG      1 - 70
SVRKTRKNKQKTPGNGDGGSTSEAPQPPRKKRARADPTVESEEAFKNRMEVKVKIPEELKPWLVEDWDLV     71 - 140
TRQKQLFQLPAKKNVDAILEEYANCKKSQGNVDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEI    141 - 210
LLAHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLGYLHDFLKYLAKNSASLFTASDYKVAS    211 - 280
AEYHRKAL                                                                  281 - 288
//

Text Mined References (25)

PMID Year Title