Property Summary

NCBI Gene PubMed Count 21
Grant Count 8
R01 Count 7
Funding $1,356,737.35
PubMed Score 7.43
PubTator Score 5.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Rheumatoid Arthritis 1.500 0.016
hepatocellular carcinoma -1.700 0.002
ependymoma 1.200 0.038
oligodendroglioma 1.100 0.018
osteosarcoma 3.584 0.000
primitive neuroectodermal tumor 1.200 0.001
adrenocortical carcinoma 1.350 0.005
intraductal papillary-mucinous adenoma (... 1.100 0.030
psoriasis -1.100 0.000
Pick disease 1.600 0.002
ovarian cancer -1.500 0.000
pituitary cancer -1.100 0.002

Gene RIF (3)

PMID Text
25796627 Suberoylanilide hydroxamic acid enhanced the expression of malignant genes such as MORF4L2 in lung cancer cells remaining after treatment, creating a more drug-resistant state.
18593893 The transcriptional status of four key genes, thymidylate synthase (TYMS), MORF-related gene X (MRGX), Bcl2-antagonist/killer (BAK), and ATPase, Cu(2+) transporting beta polypeptide (ATP7B), can accurately predict response to 5-FU.
14506250 can repress or activate the B-myb promoter depending on the cell type studied, suggesting that there may be tissue-specific functions of this protein

AA Sequence

MSSRKQGSQPRGQQSAEEENFKKPTRSNMQRSKMRGASSGKKTAGPQQKNLEPALPGRWGGRSAENPPSG      1 - 70
SVRKTRKNKQKTPGNGDGGSTSEAPQPPRKKRARADPTVESEEAFKNRMEVKVKIPEELKPWLVEDWDLV     71 - 140
TRQKQLFQLPAKKNVDAILEEYANCKKSQGNVDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEI    141 - 210
LLAHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLGYLHDFLKYLAKNSASLFTASDYKVAS    211 - 280
AEYHRKAL                                                                  281 - 288
//

Text Mined References (24)

PMID Year Title
25796627 2015 Enhancement of tumor initiation and expression of KCNMA1, MORF4L2 and ASPM genes in the adenocarcinoma of lung xenograft after vorinostat treatment.
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18593893 2008 Single-cell transcription site activation predicts chemotherapy response in human colorectal tumors.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
16230350 2005 A mammalian chromatin remodeling complex with similarities to the yeast INO80 complex.
More...