Property Summary

NCBI Gene PubMed Count 32
PubMed Score 0.91
PubTator Score 80.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (4)

Disease log2 FC p
acute myeloid leukemia 1.300 4.8e-03
group 3 medulloblastoma 1.400 2.4e-04
non primary Sjogren syndrome sicca 1.100 1.6e-02
ovarian cancer 1.100 6.8e-05

Gene RIF (18)

AA Sequence

MAAPEAEVLSSAAVPDLEWYEKSEETHASQIELLETSSTQEPLNASEAFCPRDCMVPVVFPGPVSQEGCC      1 - 70
QFTCELLKHIMYQRQQLPLPYEQLKHFYRKPSPQAEEMLKKKPRATTEVSSRKCQQALAELESVLSHLED     71 - 140
FFARTLVPRVLILLGGNALSPKEFYELDLSLLAPYSVDQSLSTAACLRRLFRAIFMADAFSELQAPPLMG    141 - 210
TVVMAQGHRNCGEDWFRPKLNYRVPSRGHKLTVTLSCGRPSIRTTAWEDYIWFQAPVTFKGFRE          211 - 274
//

Text Mined References (35)

PMID Year Title