Property Summary

NCBI Gene PubMed Count 31
Grant Count 63
R01 Count 20
Funding $7,497,865.81
PubMed Score 0.91
PubTator Score 80.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma 1.400 0.000
non primary Sjogren syndrome sicca 1.100 0.016
acute myeloid leukemia 1.300 0.005
ovarian cancer 1.100 0.000

Gene RIF (17)

PMID Text
26544187 p31comet-induced cell death is mediated by interactions with Mad2
26324890 the oligomeric form of TRIP13 binds both p31(comet) and MCC
25092294 joint action of TRIP13 and p31(comet) also promotes the release of Mad2 from MCC, participates in the complete disassembly of MCC and abrogates checkpoint inhibition of APC/C
24596092 attenuating the affinity of p31(Comet) for Mad2 by phosphorylation promotes SAC activity in mitosis. Specifically, phosphorylation of Ser-102 weakens p31(Comet)-Mad2 binding and enhances p31(Comet)-mediated bypass of the SAC.
24131926 Altered p31(Comet):Mad2 expression ratios may provide new insight into altered spindle assembly checkpoint function and the generation of chromosomal instability in tumors.
22566641 The binding of p31(comet) to Mad2 in mitotic checkpoint complex may trigger a conformational change in Cdc20 that facilitates its phosphorylation by Cdk, and that the latter process may promote its dissociation from BubR1.
22544748 the importance of p31(comet) in checkpoint silencing and its potential as a target for antimitotic therapies.
22235654 This review presents knowledge of CMT2 and possible pathogenetic mechanisms responsible for the disease
22100920 p31(comet) negatively regulates the spindle assembly checkpoint by extracting Mad2 from the MCC.
21965286 study found p31(comet) traffics on and off kinetochores and also present in the cytosol; Cells depleted of p31(comet) arrest in metaphase with mature bipolar kinetochore-microtubule attachments; propose that p31(comet) is an essential component of machinery that silences the checkpoint during each cell cycle
More...

AA Sequence

MAAPEAEVLSSAAVPDLEWYEKSEETHASQIELLETSSTQEPLNASEAFCPRDCMVPVVFPGPVSQEGCC      1 - 70
QFTCELLKHIMYQRQQLPLPYEQLKHFYRKPSPQAEEMLKKKPRATTEVSSRKCQQALAELESVLSHLED     71 - 140
FFARTLVPRVLILLGGNALSPKEFYELDLSLLAPYSVDQSLSTAACLRRLFRAIFMADAFSELQAPPLMG    141 - 210
TVVMAQGHRNCGEDWFRPKLNYRVPSRGHKLTVTLSCGRPSIRTTAWEDYIWFQAPVTFKGFRE          211 - 274
//

Text Mined References (34)

PMID Year Title
26544187 2015 p31comet-Induced Cell Death Is Mediated by Binding and Inactivation of Mad2.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26324890 2015 Mode of interaction of TRIP13 AAA-ATPase with the Mad2-binding protein p31comet and with mitotic checkpoint complexes.
25416956 2014 A proteome-scale map of the human interactome network.
25092294 2014 Disassembly of mitotic checkpoint complexes by the joint action of the AAA-ATPase TRIP13 and p31(comet).
24596092 2014 Phosphorylation regulates the p31Comet-mitotic arrest-deficient 2 (Mad2) interaction to promote spindle assembly checkpoint (SAC) activity.
24131926 2013 Coordinated regulation of p31(Comet) and Mad2 expression is required for cellular proliferation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22566641 2012 Role of phosphorylation of Cdc20 in p31(comet)-stimulated disassembly of the mitotic checkpoint complex.
22544748 2012 Depletion of p31comet protein promotes sensitivity to antimitotic drugs.
More...