Property Summary

NCBI Gene PubMed Count 50
PubMed Score 68.92
PubTator Score 155.71

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytoma 1.100 4.1e-03
colon cancer -1.500 4.3e-02
glioblastoma 1.500 5.9e-03
intraductal papillary-mucinous carcinoma... -1.300 7.7e-03
intraductal papillary-mucinous neoplasm ... -1.300 3.7e-03
lung cancer -1.400 8.8e-03
non primary Sjogren syndrome sicca 1.500 2.7e-02
ovarian cancer -2.100 1.2e-08
periodontitis 1.100 8.4e-22

 GO Function (1)

Protein-protein Interaction (1)

Gene RIF (25)

AA Sequence

MESETEPEPVTLLVKSPNQRHRDLELSGDRGWSVGHLKAHLSRVYPERPRPEDQRLIYSGKLLLDHQCLR      1 - 70
DLLPKQEKRHVLHLVCNVKSPSKMPEINAKVAESTEEPAGSNRGQYPEDSSSDGLRQREVLRNLSSPGWE     71 - 140
NISRPEAAQQAFQGLGPGFSGYTPYGWLQLSWFQQIYARQYYMQYLAATAASGAFVPPPSAQEIPVVSAP    141 - 210
APAPIHNQFPAENQPANQNAAPQVVVNPGANQNLRMNAQGGPIVEEDDEINRDWLDWTYSAATFSVFLSI    211 - 280
LYFYSSLSRFLMVMGATVVMYLHHVGWFPFRPRPVQNFPNDGPPPDVVNQDPNNNLQEGTDPETEDPNHL    281 - 350
PPDRDVLDGEQTSPSFMSTAWLVFKTFFASLLPEGPPAIAN                                 351 - 391
//

Text Mined References (54)

PMID Year Title