Property Summary

NCBI Gene PubMed Count 45
Grant Count 57
R01 Count 23
Funding $31,993,765.67
PubMed Score 66.30
PubTator Score 155.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytoma 1.100 0.004
glioblastoma 1.500 0.006
periodontitis 1.100 0.000
intraductal papillary-mucinous carcinoma... -1.300 0.008
intraductal papillary-mucinous neoplasm ... -1.300 0.004
colon cancer -1.500 0.043
lung cancer -1.600 0.000
non primary Sjogren syndrome sicca 1.500 0.027
ovarian cancer -2.100 0.000

Synonym

Accession Q15011 E9PGD1 O60644 Q6IAN8 Q96D92
Symbols SUP
HERP
Mif1

Gene

PDB

1WGD  

 GO Function (1)

Gene RIF (21)

PMID Text
26823705 HERPUD1 SNPs are highly associated with polypoidal choroidal vasculopathy.
26616647 concluded that the HERPUD1-mediated cytoprotective effect against oxidative stress depends on the ITPR and Ca(2+) transfer from the endoplasmic reticulum to mitochondria
25637874 The results indicate that Nrf1 is a transcriptional activator of Herpud1 expression during ER stress, and they suggest Nrf1 is a key player in the regulation of the ER stress response in cells.
24120520 Herp operates as a relevant factor in the defense against glucose starvation by modulating autophagy levels.
23372434 Together with histological grade, increased co-expression of MIF and MMP9 in tumor might be a valuable predictor for recurrence, especially for benign meningiomas
21149444 binding of Herp to Hrd1-containing ERAD complexes positively regulates the ubiquitylation activity of these complexes, thus permitting survival of the cell during ER stress.
20604806 The results suggest that ERAD molecule Herp may delay the degradation of cytosolic proteins at the ubiquitination step.
20147634 Herp mimics structural determinants of DNA immunologically and can be immunogenic in vivo. Thus, Herp represents a candidate autoantigen for anti-DNA antibodies.
20054003 Data show that that 4-trifluoromethyl-celecoxib can inhibit secretion but not transcription of IL-12 (p35/p40) and IL-23 (p40/p19 heterodimers), and that this is associated with HERP function in the endoplasmic reticulum.
19788048 Herp may play a role in the initiation of the well-known inflammation-like changes in Parkinson disease substantia nigra and serve as a molecular link between degeneration and neuroinflammation in Parkinson disease
More...

AA Sequence

MESETEPEPVTLLVKSPNQRHRDLELSGDRGWSVGHLKAHLSRVYPERPRPEDQRLIYSGKLLLDHQCLR      1 - 70
DLLPKQEKRHVLHLVCNVKSPSKMPEINAKVAESTEEPAGSNRGQYPEDSSSDGLRQREVLRNLSSPGWE     71 - 140
NISRPEAAQQAFQGLGPGFSGYTPYGWLQLSWFQQIYARQYYMQYLAATAASGAFVPPPSAQEIPVVSAP    141 - 210
APAPIHNQFPAENQPANQNAAPQVVVNPGANQNLRMNAQGGPIVEEDDEINRDWLDWTYSAATFSVFLSI    211 - 280
LYFYSSLSRFLMVMGATVVMYLHHVGWFPFRPRPVQNFPNDGPPPDVVNQDPNNNLQEGTDPETEDPNHL    281 - 350
PPDRDVLDGEQTSPSFMSTAWLVFKTFFASLLPEGPPAIAN                                 351 - 391
//

Text Mined References (49)

PMID Year Title
26823705 2015 Evidence of a novel gene HERPUD1 in polypoidal choroidal vasculopathy.
26616647 2016 HERPUD1 protects against oxidative stress-induced apoptosis through downregulation of the inositol 1,4,5-trisphosphate receptor.
25660456 2015 Identification of ERAD components essential for dislocation of the null Hong Kong variant of ?-1-antitrypsin (NHK).
25637874 2015 Induction of Herpud1 expression by ER stress is regulated by Nrf1.
24886709 2014 Amerindian-specific regions under positive selection harbour new lipid variants in Latinos.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24120520 2013 Herp depletion protects from protein aggregation by up-regulating autophagy.
23505323 2013 Genomic study in Mexicans identifies a new locus for triglycerides and refines European lipid loci.
23372434 2013 Increased co-expression of macrophage migration inhibitory factor and matrix metalloproteinase 9 is associated with tumor recurrence of meningioma.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
More...