Property Summary

NCBI Gene PubMed Count 29
PubMed Score 23.12
PubTator Score 7.72

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q15008 A8K2E0 E9PHI9 Q6UV22
Symbols S10
Rpn7
p42A
p44S10
SGA-113M

Gene

PDB

5GJQ   5GJR   5LN3   5M32   5T0C   5T0G   5T0H   5T0I   5T0J   5VGZ   5VHF   5VHH   5VHI   5VHS   5L4K  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GWAS Trait (1)

Gene RIF (28)

AA Sequence

MPLENLEEEGLPKNPDLRIAQLRFLLSLPEHRGDAAVRDELMAAVRDNNMAPYYEALCKSLDWQIDVDLL      1 - 70
NKMKKANEDELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFRKTYDKTVALGHRLDI     71 - 140
VFYLLRIGLFYMDNDLITRNTEKAKSLIEEGGDWDRRNRLKVYQGLYCVAIRDFKQAAELFLDTVSTFTS    141 - 210
YELMDYKTFVTYTVYVSMIALERPDLREKVIKGAEILEVLHSLPAVRQYLFSLYECRYSVFFQSLAVVEQ    211 - 280
EMKKDWLFAPHYRYYVREMRIHAYSQLLESYRSLTLGYMAEAFGVGVEFIDQELSRFIAAGRLHCKIDKV    281 - 350
NEIVETNRPDSKNWQYQETIKKGDLLLNRVQKLSRVINM                                   351 - 389
//

Text Mined References (38)

PMID Year Title