Property Summary

NCBI Gene PubMed Count 32
PubMed Score 15.85
PubTator Score 20.71

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
acute quadriplegic myopathy 1.090 2.5e-04
group 3 medulloblastoma 1.200 1.3e-02
juvenile dermatomyositis 1.017 6.1e-12
Multiple myeloma 1.124 2.5e-02
osteosarcoma -1.505 6.5e-06
ovarian cancer -2.200 3.1e-06
primary pancreatic ductal adenocarcinoma 1.072 4.0e-02
tuberculosis -1.100 6.0e-05

Gene RIF (12)

AA Sequence

MTNEEPLPKKVRLSETDFKVMARDELILRWKQYEAYVQALEGKYTDLNSNDVTGLRESEEKLKQQQQESA      1 - 70
RRENILVMRLATKEQEMQECTTQIQYLKQVQQPSVAQLRSTMVDPAINLFFLKMKGELEQTKDKLEQAQN     71 - 140
ELSAWKFTPDSQTGKKLMAKCRMLIQENQELGRQLSQGRIAQLEAELALQKKYSEELKSSQDELNDFIIQ    141 - 210
LDEEVEGMQSTILVLQQQLKETRQQLAQYQQQQSQASAPSTSRTTASEPVEQSEATSKDCSRLTNGPSNG    211 - 280
SSSRQRTSGSGFHREGNTTEDDFPSSPGNGNKSSNSSEERTGRGGSGYVNQLSAGYESVDSPTGSENSLT    281 - 350
HQSNDTDSSHDPQEEKAVSGKGNRTVGSRHVQNGLDSSVNVQGSVL                            351 - 396
//

Text Mined References (43)

PMID Year Title