Property Summary

NCBI Gene PubMed Count 31
PubMed Score 14.27
PubTator Score 20.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Multiple myeloma 1.124 0.025
osteosarcoma -1.505 0.000
acute quadriplegic myopathy 1.125 0.000
juvenile dermatomyositis 1.017 0.000
primary pancreatic ductal adenocarcinoma 1.072 0.040
tuberculosis -1.400 0.000
group 3 medulloblastoma 1.200 0.013
ovarian cancer -2.200 0.000

Synonym

Accession Q15007 Q5TCL8 Q5TCL9 Q96T28 Q9BYJ7 Q9H4E2
Symbols Mum2

Gene

Gene RIF (11)

PMID Text
24413322 WTAP has an important role in abnormal proliferation and arrested differentiation of leukemia cells, and WTAP is a novel client protein of Hsp90
24407421 WTAP as a regulatory subunit is required for formation of a functional m6A methyltransferase complex including METTL3 and METTL14, which play an important role in the regulation of gene expression and alternative splicing.
24100041 the WTAP complex is a novel component of the RNA processing machinery, implying an important role in both posttranscriptional control and cell cycle regulation.
23354623 WTAP regulates migration and invasion of cholangiocarcinoma cells.
22957919 WTAP overexpression made cancer cells more tumorigenic
19969384 WTAP level in poodocytes is a valuable alternative technique in the study of podocyte injury in diabetic nephropathy.
19605357 Nuclear degradation of Wilms tumor 1-associating protein and survivin splice variant switching underlie IGF-1-mediated survival
17095724 WTAP is a novel regulator of the cell cycle and cell survival and implicate a WTAP-WT1 axis as a novel pathway for controlling vascular smooth muscle cell phenotype.
17088532 WTAP as an essential factor for the stabilization of cyclin A2 mRNA, thereby regulating G2/M cell-cycle transition
16912181 WTAP and ATF3 Transcription Factor are activated in Wilms' tumor and accelerate tumorigenesis.
More...

AA Sequence

MTNEEPLPKKVRLSETDFKVMARDELILRWKQYEAYVQALEGKYTDLNSNDVTGLRESEEKLKQQQQESA      1 - 70
RRENILVMRLATKEQEMQECTTQIQYLKQVQQPSVAQLRSTMVDPAINLFFLKMKGELEQTKDKLEQAQN     71 - 140
ELSAWKFTPDSQTGKKLMAKCRMLIQENQELGRQLSQGRIAQLEAELALQKKYSEELKSSQDELNDFIIQ    141 - 210
LDEEVEGMQSTILVLQQQLKETRQQLAQYQQQQSQASAPSTSRTTASEPVEQSEATSKDCSRLTNGPSNG    211 - 280
SSSRQRTSGSGFHREGNTTEDDFPSSPGNGNKSSNSSEERTGRGGSGYVNQLSAGYESVDSPTGSENSLT    281 - 350
HQSNDTDSSHDPQEEKAVSGKGNRTVGSRHVQNGLDSSVNVQGSVL                            351 - 396
//

Text Mined References (42)

PMID Year Title
26458103 2015 Dynamic m(6)A mRNA methylation directs translational control of heat shock response.
25416956 2014 A proteome-scale map of the human interactome network.
24981863 2014 Perturbation of m6A writers reveals two distinct classes of mRNA methylation at internal and 5' sites.
24413322 2014 WTAP is a novel oncogenic protein in acute myeloid leukemia.
24407421 2014 Mammalian WTAP is a regulatory subunit of the RNA N6-methyladenosine methyltransferase.
24316715 2014 A METTL3-METTL14 complex mediates mammalian nuclear RNA N6-adenosine methylation.
24100041 2013 Identification of Wilms' tumor 1-associating protein complex and its role in alternative splicing and the cell cycle.
23354623 2013 WTAP regulates migration and invasion of cholangiocarcinoma cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22957919 2012 Expression and roles of Wilms' tumor 1-associating protein in glioblastoma.
More...