Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.68
PubTator Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

 GO Function (1)

Gene RIF (2)

AA Sequence

MAAAAVQGGRSGGSGGCSGAGGASNCGTGSGRSGLLDKWKIDDKPVKIDKWDGSAVKNSLDDSAKKVLLE      1 - 70
KYKYVENFGLIDGRLTICTISCFFAIVALIWDYMHPFPESKPVLALCVISYFVMMGILTIYTSYKEKSIF     71 - 140
LVAHRKDPTGMDPDDIWQLSSSLKRFDDKYTLKLTFISGRTKQQREAEFTKSIAKFFDHSGTLVMDAYEP    141 - 210
EISRLHDSLAIERKIK                                                          211 - 226
//

Text Mined References (13)

PMID Year Title