Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.68
PubTator Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Pituitary hypoplasia 15 5.117 2.6

Expression

Synonym

Gene

PANTHER Protein Class (1)

 GO Function (1)

Gene RIF (2)

PMID Text
22190034 HIV-1 gp41 is identified to have a physical interaction with signal peptidase complex subunit 2 homolog (SPCS2) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22082156 Knockdown of signal peptidase complex subunit 2 homolog (S. cerevisiae; SPCS2) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N

AA Sequence

MAAAAVQGGRSGGSGGCSGAGGASNCGTGSGRSGLLDKWKIDDKPVKIDKWDGSAVKNSLDDSAKKVLLE      1 - 70
KYKYVENFGLIDGRLTICTISCFFAIVALIWDYMHPFPESKPVLALCVISYFVMMGILTIYTSYKEKSIF     71 - 140
LVAHRKDPTGMDPDDIWQLSSSLKRFDDKYTLKLTFISGRTKQQREAEFTKSIAKFFDHSGTLVMDAYEP    141 - 210
EISRLHDSLAIERKIK                                                          211 - 226
//

Text Mined References (13)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24480542 2014 Defective minor spliceosome mRNA processing results in isolated familial growth hormone deficiency.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
More...