Property Summary

NCBI Gene PubMed Count 43
PubMed Score 2381.28
PubTator Score 668.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (38)

Disease log2 FC p
adrenocortical carcinoma 4.381 1.6e-08
adult high grade glioma 3.200 9.6e-05
astrocytic glioma 1.200 1.7e-02
Astrocytoma, Pilocytic 1.700 1.8e-04
Atopic dermatitis 1.700 1.3e-04
atypical teratoid / rhabdoid tumor 4.500 3.2e-13
Breast cancer 2.700 4.8e-25
breast carcinoma 2.600 6.1e-07
chronic rhinosinusitis 1.069 2.9e-02
COPD 1.300 4.8e-02
cystic fibrosis and chronic rhinosinusit... 1.302 2.0e-03
ductal carcinoma in situ 3.800 5.3e-04
Endometriosis 1.991 1.4e-02
ependymoma 1.400 1.6e-02
glioblastoma 4.000 1.7e-13
group 3 medulloblastoma 5.700 4.1e-08
interstitial cystitis 1.300 4.9e-03
intraductal papillary-mucinous carcinoma... 2.800 2.9e-03
intraductal papillary-mucinous neoplasm ... 3.900 4.6e-03
invasive ductal carcinoma 4.700 5.0e-04
juvenile dermatomyositis 1.033 5.3e-09
lung adenocarcinoma 1.300 4.4e-10
lung cancer 4.000 2.4e-05
malignant mesothelioma 1.400 9.1e-06
medulloblastoma, large-cell 5.200 1.2e-06
Multiple myeloma 1.097 4.6e-02
nasopharyngeal carcinoma 1.600 2.4e-05
non-small cell lung cancer 3.757 2.0e-30
oligodendroglioma 1.400 8.5e-03
ovarian cancer 2.000 8.2e-05
pancreatic cancer 1.500 9.7e-06
pancreatic ductal adenocarcinoma liver m... 1.938 8.6e-03
primary Sjogren syndrome 1.800 9.1e-04
primitive neuroectodermal tumor 4.400 5.6e-07
psoriasis 1.800 2.7e-08
tuberculosis 1.700 1.8e-04
ulcerative colitis 1.300 2.7e-06
Waldenstrons macroglobulinemia 2.177 2.0e-02

 GO Function (1)

Gene RIF (33)

AA Sequence

MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFR      1 - 70
LSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE                                  71 - 111
//

Text Mined References (50)

PMID Year Title