Property Summary

NCBI Gene PubMed Count 36
Grant Count 357
R01 Count 210
Funding $53,533,545.34
PubMed Score 2307.05
PubTator Score 668.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (52)

Disease Z-score Confidence
Atrial Fibrillation 110 6.572 3.3
Asthma 349 4.873 2.4
Multiple system atrophy 27 4.004 2.0
Eosinophilia 65 3.693 1.8
Cerebrovascular disease 231 3.671 1.8
Pleurisy 18 3.556 1.8
Perinatal necrotizing enterocolitis 18 3.318 1.7
Pancreatitis 97 3.259 1.6
Cardiac tamponade 4 3.107 1.6
Allergic rhinitis 91 3.096 1.5
Hypertension 287 3.091 1.5
Cancer 2,346 3.051 1.5
Allergic hypersensitivity disease 123 3.045 1.5
Atopic dermatitis 944
Breast cancer 3,094
COPD 113
Endometriosis 535
IGA Glomerulonephritis 454
Multiple myeloma 1,327
Waldenstrons macroglobulinemia 765
adrenocortical carcinoma 1,427
astrocytic glioma 2,241
atypical teratoid/rhabdoid tumor 1,095
breast carcinoma 1,614
chronic rhinosinusitis 512
cystic fibrosis and chronic rhinosinusit... 213 
ductal carcinoma in situ 1,745
glioblastoma 5,572
group 3 medulloblastoma 2,254
interstitial cystitis 2,299
intraductal papillary-mucinous carcinoma... 2,988 
intraductal papillary-mucinous neoplasm ... 3,289 
invasive ductal carcinoma 2,950
juvenile dermatomyositis 1,189
lung adenocarcinoma 2,713
lung cancer 4,466
malignant mesothelioma 3,162
medulloblastoma, large-cell 6,234
nasopharyngeal carcinoma 1,056
non-small cell lung cancer 2,798
oligodendroglioma 2,849
ovarian cancer 8,484
pancreatic cancer 2,300
pancreatic ductal adenocarcinoma liver m... 1,795 
pediatric high grade glioma 2,712
pilocytic astrocytoma 3,086
posterior fossa group A ependymoma 1,511
primary Sjogren syndrome 789
primitive neuroectodermal tumor 3,031
psoriasis 6,685
tuberculosis 1,557
ulcerative colitis 2,087

Expression

Synonym

Accession Q15004 A6NNU5 A8K3Y3 G9G694 G9G696
Symbols L5
PAF
OEATC
PAF15
OEATC1
p15PAF
NS5ATP9
OEATC-1
p15/PAF
KIAA0101
p15(PAF)

Gene

PDB

4D2G  

 GO Function (1)

Gene RIF (27)

PMID Text
26843124 Results unveil an unsuspected role of the PAF-Wnt signalling axis in modulating cell plasticity, which is required for the maintenance of breast cancer cell stemness.
26155891 IN PATIENTS WITH HEPATITIS C VIRUS GENOTYPE 1B, TREATMENT RESPONSE WITH DACLATASVIR PLUS ASUNAPREVIR WITHOUT NS5A-L31F/I/M/V and/or NS5A-Y93H polymorphisms
25762514 p15PAF acts as a flexible drag that regulates PCNA sliding along the DNA and facilitates the switch from replicative to translesion synthesis polymerase binding.
25649430 Results indicated that the expression of NS5ATP9 was up-regulated by starvation and that Beclin 1 was involved in autophagy induced in hepatoblastoma cells by starvation.
24996800 NS5ATP9 mRNA overexpression in peripheral blood mononuclear cells was significantly associated with poor disease-free survival and overall survival of gastric cancer patients, but not with tumor recurrence.
24750205 These results highlight an important potential role for NS5ATP9 in hepatitis C virus NS5A-induced hepatocyte autophagy.
24197986 overexpression of KIAA0101 mRNA in peripheral blood mononuclear cells could act as a predictive biomarker for hepatic cancer
24145239 Upregulated expression of KIAA0101 is associated with esophageal cancer progression, resistance to chemotherapy, and poor survival.
24055345 Data indicate that PAF-EZH2-beta-catenin complex hyperactivates Wnt signaling.
23698777 Data show that hepatitis C virus NS5A-transactivated protein 9 (NS5ATP9) knockdown activated mitogen-activated protein kinase kinase/extracellular signal regulated kinases 1/2 signaling under C virus nonstructural protein 5A (NS5A) expression.
More...

AA Sequence

MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFR      1 - 70
LSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE                                  71 - 111
//

Text Mined References (39)

PMID Year Title
26843124 2016 PAF-Wnt signaling-induced cell plasticity is required for maintenance of breast cancer cell stemness.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26155891 2015 High Sustained Virologic Response to Daclatasvir Plus Asunaprevir in Elderly and Cirrhotic Patients with Hepatitis C Virus Genotype 1b Without Baseline NS5A Polymorphisms.
25762514 2015 Structure of p15(PAF)-PCNA complex and implications for clamp sliding during DNA replication and repair.
25649430 2015 NS5ATP9 Promotes Beclin 1-Dependent Starvation-Induced Autophagy of Hepatoblastoma Cells.
24996800 2014 NS5ATP9 mRNA levels in peripheral blood mononuclear cells predict prognosis in patients with gastric cancer.
24750205 2014 A functional role for NS5ATP9 in the induction of HCV NS5A-mediated autophagy.
24197986 2014 KIAA0101 mRNA overexpression in peripheral blood mononuclear cells acts as predictive marker for hepatic cancer.
24145239 2013 Expression of KIAA0101 protein is associated with poor survival of esophageal cancer patients and resistance to cisplatin treatment in vitro.
24055345 2013 PAF and EZH2 induce Wnt/?-catenin signaling hyperactivation.
More...