Property Summary

NCBI Gene PubMed Count 16
Grant Count 10
R01 Count 2
Funding $2,414,819.72
PubMed Score 29.78
PubTator Score 11.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
malignant mesothelioma 1.900 0.000
psoriasis 1.800 0.000
osteosarcoma -1.066 0.049
glioblastoma 2.400 0.000
group 3 medulloblastoma 2.500 0.000
atypical teratoid / rhabdoid tumor 2.300 0.000
medulloblastoma, large-cell 2.900 0.000
primitive neuroectodermal tumor 2.600 0.000
adrenocortical carcinoma 1.066 0.007
non-small cell lung cancer 2.271 0.000
lung cancer 2.700 0.000
colon cancer 1.800 0.003
breast carcinoma 1.400 0.000
lung adenocarcinoma 1.400 0.000
pediatric high grade glioma 2.000 0.000
Breast cancer 1.700 0.000
ductal carcinoma in situ 1.200 0.002
invasive ductal carcinoma 1.800 0.000
ovarian cancer 1.800 0.000

Gene RIF (3)

PMID Text
21151026 Caspase-3-mediated degradation of condensin Cap-H regulates mitotic cell death.
19454010 Interaction of HIV-1 Tat with CAPH in T-cells is identified by a proteomic strategy based on affinity chromatography coupled with mass spectrometry
16543152 Our results identify a SSB-specific response of condensin I through PARP-1 and demonstrate a role for condensin in SSB. repair.

AA Sequence

MGPPGPALPATMNNSSSETRGHPHSASSPSERVFPMPLPRKAPLNIPGTPVLEDFPQNDDEKERLQRRRS      1 - 70
RVFDLQFSTDSPRLLASPSSRSIDISATIPKFTNTQITEHYSTCIKLSTENKITTKNAFGLHLIDFMSEI     71 - 140
LKQKDTEPTNFKVAAGTLDASTKIYAVRVDAVHADVYRVLGGLGKDAPSLEEVEGHVADGSATEMGTTKK    141 - 210
AVKPKKKHLHRTIEQNINNLNVSEADRKCEIDPMFQKTAASFDECSTAGVFLSTLHCQDYRSELLFPSDV    211 - 280
QTLSTGEPLELPELGCVEMTDLKAPLQQCAEDRQICPSLAGFQFTQWDSETHNESVSALVDKFKKNDQVF    281 - 350
DINAEVDESDCGDFPDGSLGDDFDANDEPDHTAVGDHEEFRSWKEPCQVQSCQEEMISLGDGDIRTMCPL    351 - 420
LSMKPGEYSYFSPRTMSMWAGPDHWRFRPRRKQDAPSQSENKKKSTKKDFEIDFEDDIDFDVYFRKTKAA    421 - 490
TILTKSTLENQNWRATTLPTDFNYNVDTLVQLHLKPGTRLLKMAQGHRVETEHYEEIEDYDYNNPNDTSN    491 - 560
FCPGLQAADSDDEDLDDLFVGPVGNSDLSPYPCHPPKTAQQNGDTPEAQGLDITTYGESNLVAEPQKVNK    561 - 630
IEIHYAKTAKKMDMKKLKQSMWSLLTALSGKEADAEANHREAGKEAALAEVADEKMLSGLTKDLQRSLPP    631 - 700
VMAQNLSIPLAFACLLHLANEKNLKLEGTEDLSDVLVRQGD                                 701 - 741
//

Text Mined References (28)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21730191 2011 DEAD-box RNA helicase Belle/DDX3 and the RNA interference pathway promote mitotic chromosome segregation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21151026 2011 Caspase-3-mediated degradation of condensin Cap-H regulates mitotic cell death.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...