Property Summary

NCBI Gene PubMed Count 18
PubMed Score 35.65
PubTator Score 11.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adrenocortical carcinoma 1.066 7.3e-03
adult high grade glioma 1.400 5.2e-04
atypical teratoid / rhabdoid tumor 2.300 6.5e-10
Breast cancer 1.700 4.6e-11
breast carcinoma 1.400 2.4e-05
colon cancer 1.800 2.8e-03
ductal carcinoma in situ 1.200 1.6e-03
glioblastoma 1.900 7.8e-09
group 3 medulloblastoma 2.500 4.4e-06
invasive ductal carcinoma 1.800 3.3e-05
lung adenocarcinoma 1.300 2.6e-13
lung cancer 1.500 2.4e-03
malignant mesothelioma 1.900 1.1e-07
medulloblastoma, large-cell 2.900 3.6e-07
non-small cell lung cancer 2.271 2.1e-25
osteosarcoma -1.066 4.9e-02
ovarian cancer 1.800 2.4e-07
primitive neuroectodermal tumor 2.600 1.4e-05
psoriasis 1.100 5.5e-03

Gene RIF (4)

AA Sequence

MGPPGPALPATMNNSSSETRGHPHSASSPSERVFPMPLPRKAPLNIPGTPVLEDFPQNDDEKERLQRRRS      1 - 70
RVFDLQFSTDSPRLLASPSSRSIDISATIPKFTNTQITEHYSTCIKLSTENKITTKNAFGLHLIDFMSEI     71 - 140
LKQKDTEPTNFKVAAGTLDASTKIYAVRVDAVHADVYRVLGGLGKDAPSLEEVEGHVADGSATEMGTTKK    141 - 210
AVKPKKKHLHRTIEQNINNLNVSEADRKCEIDPMFQKTAASFDECSTAGVFLSTLHCQDYRSELLFPSDV    211 - 280
QTLSTGEPLELPELGCVEMTDLKAPLQQCAEDRQICPSLAGFQFTQWDSETHNESVSALVDKFKKNDQVF    281 - 350
DINAEVDESDCGDFPDGSLGDDFDANDEPDHTAVGDHEEFRSWKEPCQVQSCQEEMISLGDGDIRTMCPL    351 - 420
LSMKPGEYSYFSPRTMSMWAGPDHWRFRPRRKQDAPSQSENKKKSTKKDFEIDFEDDIDFDVYFRKTKAA    421 - 490
TILTKSTLENQNWRATTLPTDFNYNVDTLVQLHLKPGTRLLKMAQGHRVETEHYEEIEDYDYNNPNDTSN    491 - 560
FCPGLQAADSDDEDLDDLFVGPVGNSDLSPYPCHPPKTAQQNGDTPEAQGLDITTYGESNLVAEPQKVNK    561 - 630
IEIHYAKTAKKMDMKKLKQSMWSLLTALSGKEADAEANHREAGKEAALAEVADEKMLSGLTKDLQRSLPP    631 - 700
VMAQNLSIPLAFACLLHLANEKNLKLEGTEDLSDVLVRQGD                                 701 - 741
//

Text Mined References (31)

PMID Year Title