Property Summary

NCBI Gene PubMed Count 14
PubMed Score 15.06
PubTator Score 5.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
pancreatic cancer -1.400 0.002
osteosarcoma -2.634 0.000
glioblastoma 1.500 0.007
cystic fibrosis 4.202 0.000
atypical teratoid / rhabdoid tumor 1.900 0.008
adrenocortical carcinoma -2.023 0.023
non-small cell lung cancer -4.007 0.000
intraductal papillary-mucinous adenoma (... -2.700 0.000
intraductal papillary-mucinous carcinoma... -2.800 0.000
lung adenocarcinoma -2.500 0.000
adult high grade glioma 1.600 0.000
pancreatic carcinoma 1.200 0.000
lung carcinoma -2.700 0.000
Breast cancer -1.100 0.000
pituitary cancer -2.500 0.000

Gene RIF (5)

PMID Text
26039994 studies indicate that VEPH1 inhibits TGF-beta signaling by impeding the release of activated SMAD2 from TbetaRI and may modulate TGF-beta signaling during development and cancer initiation or progression
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MHQLFRLVLGQKDLSRAGDLFSLDDSEIEDSLTEALEQIKIISSSSDYQTNNNDQAVVEICITRITTAIR      1 - 70
ETESIEKHAKALVGLWDSCLEHNLRPFGKDEDTPHAKIASDIMSCILQNYNRPPVMALAIPIAVKFLHRG     71 - 140
NKELCRNMSNYLSLAAITKADLLADHTEVIVKSILQGNTMLLRVLPAVYEKQPQPINRHLTELLALMSQL    141 - 210
EQPEQYHLLRLLHVAAKKKQLEVVQKCIPFLIGHLKDSTHNDIILNILIEIAVYEPVALNSFLPMLKEIG    211 - 280
ERFPYLTGQMARIYGAVGHVDEERARSCLTYLVSQLANMEHSFHHILLLEIKSITDTFSSILGPQSRDIF    281 - 350
RMSNSFTAIAKLLTRQLENTKAGSGRRKISTEIEFPEKLEETKLIVTENEDHEKLQVKIQAFEDKINAGS    351 - 420
NTPGSIRRYSLGQVSKEERKNIRFNRSKSLAFHTMLTKGVGSDDGEDENRGDIPASISLSEIDPLGQGND    421 - 490
KLPFKTDTERSQLGESSVSYPNIIHIDSENLSETVKENSQEETPETTASPIEYQDKLYLHLKKNLSKVKA    491 - 560
YAMEIGKKIPVPDQCTIEDTVRSCVAKLFFTCSLKGHYCLYSKSSFILISQEPQPWIQIMFLFQQSLFPE    561 - 630
PLSIQSHSVQFLRALWEKTQAGGAHSFETAMMESTFPQQKDLDQVQLHLEEVRFFDVFGFSETAGAWQCF    631 - 700
MCNNPEKATVVNQDGQPLIEGKLKEKQVRWKFIKRWKTRYFTLAGNQLLFQKGKSKDDPDDCPIELSKVQ    701 - 770
SVKAVAKKRRDRSLPRAFEIFTDNKTYVFKAKDEKNAEEWLQCINVAVAQAKERESREVTTYL           771 - 833
//

Text Mined References (18)

PMID Year Title
26039994 2015 Human ortholog of Drosophila Melted impedes SMAD2 release from TGF-? receptor I to inhibit TGF-? signaling.
21685187 2011 Genome-wide association study of smoking behaviours in patients with COPD.
21441570 2011 Genome-wide meta-analysis for severe diabetic retinopathy.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...