Property Summary

NCBI Gene PubMed Count 14
PubMed Score 15.06
PubTator Score 5.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
pancreatic cancer -1.400 1.5e-03
osteosarcoma -2.634 2.9e-06
glioblastoma 1.500 7.2e-03
cystic fibrosis 4.202 2.0e-07
atypical teratoid / rhabdoid tumor 1.900 7.7e-03
adrenocortical carcinoma -2.023 2.3e-02
non-small cell lung cancer -4.007 7.7e-37
intraductal papillary-mucinous adenoma (... -2.700 5.5e-05
intraductal papillary-mucinous carcinoma... -2.800 1.0e-04
lung adenocarcinoma -2.500 1.6e-11
adult high grade glioma 1.600 4.1e-04
pancreatic carcinoma 1.200 6.6e-05
lung carcinoma -2.700 2.8e-21
Breast cancer -1.100 8.0e-07
pituitary cancer -2.500 1.6e-04

Gene RIF (5)

PMID Text
26039994 studies indicate that VEPH1 inhibits TGF-beta signaling by impeding the release of activated SMAD2 from TbetaRI and may modulate TGF-beta signaling during development and cancer initiation or progression
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MHQLFRLVLGQKDLSRAGDLFSLDDSEIEDSLTEALEQIKIISSSSDYQTNNNDQAVVEICITRITTAIR      1 - 70
ETESIEKHAKALVGLWDSCLEHNLRPFGKDEDTPHAKIASDIMSCILQNYNRPPVMALAIPIAVKFLHRG     71 - 140
NKELCRNMSNYLSLAAITKADLLADHTEVIVKSILQGNTMLLRVLPAVYEKQPQPINRHLTELLALMSQL    141 - 210
EQPEQYHLLRLLHVAAKKKQLEVVQKCIPFLIGHLKDSTHNDIILNILIEIAVYEPVALNSFLPMLKEIG    211 - 280
ERFPYLTGQMARIYGAVGHVDEERARSCLTYLVSQLANMEHSFHHILLLEIKSITDTFSSILGPQSRDIF    281 - 350
RMSNSFTAIAKLLTRQLENTKAGSGRRKISTEIEFPEKLEETKLIVTENEDHEKLQVKIQAFEDKINAGS    351 - 420
NTPGSIRRYSLGQVSKEERKNIRFNRSKSLAFHTMLTKGVGSDDGEDENRGDIPASISLSEIDPLGQGND    421 - 490
KLPFKTDTERSQLGESSVSYPNIIHIDSENLSETVKENSQEETPETTASPIEYQDKLYLHLKKNLSKVKA    491 - 560
YAMEIGKKIPVPDQCTIEDTVRSCVAKLFFTCSLKGHYCLYSKSSFILISQEPQPWIQIMFLFQQSLFPE    561 - 630
PLSIQSHSVQFLRALWEKTQAGGAHSFETAMMESTFPQQKDLDQVQLHLEEVRFFDVFGFSETAGAWQCF    631 - 700
MCNNPEKATVVNQDGQPLIEGKLKEKQVRWKFIKRWKTRYFTLAGNQLLFQKGKSKDDPDDCPIELSKVQ    701 - 770
SVKAVAKKRRDRSLPRAFEIFTDNKTYVFKAKDEKNAEEWLQCINVAVAQAKERESREVTTYL           771 - 833
//

Text Mined References (18)

PMID Year Title
26039994 2015 Human ortholog of Drosophila Melted impedes SMAD2 release from TGF-? receptor I to inhibit TGF-? signaling.
21685187 2011 Genome-wide association study of smoking behaviours in patients with COPD.
21441570 2011 Genome-wide meta-analysis for severe diabetic retinopathy.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16054033 2005 Drosophila Melted modulates FOXO and TOR activity.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15388229 2004 Identification and characterization of Veph, a novel gene encoding a PH domain-containing protein expressed in the developing central nervous system of vertebrates.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
11214970 2000 Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.