Property Summary

NCBI Gene PubMed Count 39
PubMed Score 45.56
PubTator Score 40.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -4.100 1.4e-09
breast carcinoma -1.400 7.6e-04
ductal carcinoma in situ -2.200 3.1e-04
fibroadenoma -1.700 4.6e-02
glioblastoma -1.900 4.8e-03
group 3 medulloblastoma -2.700 4.8e-04
invasive ductal carcinoma -2.300 2.3e-03
medulloblastoma, large-cell -4.300 1.9e-08
pediatric high grade glioma -1.300 8.9e-03
primitive neuroectodermal tumor -2.500 9.7e-03
psoriasis -1.600 1.8e-15

Gene RIF (36)

AA Sequence

MKRERGALSRASRALRLAPFVYLLLIQTDPLEGVNITSPVRLIHGTVGKSALLSVQYSSTSSDRPVVKWQ      1 - 70
LKRDKPVTVVQSIGTEVIGTLRPDYRDRIRLFENGSLLLSDLQLADEGTYEVEISITDDTFTGEKTINLT     71 - 140
VDVPISRPQVLVASTTVLELSEAFTLNCSHENGTKPSYTWLKDGKPLLNDSRMLLSPDQKVLTITRVLME    141 - 210
DDDLYSCMVENPISQGRSLPVKITVYRRSSLYIILSTGGIFLLVTLVTVCACWKPSKRKQKKLEKQNSLE    211 - 280
YMDQNDDRLKPEADTLPRSGEQERKNPMALYILKDKDSPETEENPAPEPRSATEPGPPGYSVSPAVPGRS    281 - 350
PGLPIRSARRYPRSPARSPATGRTHSSPPRAPSSPGRSRSASRTLRTAGVHIIREQDEAGPVEISA        351 - 416
//

Text Mined References (42)

PMID Year Title