Property Summary

NCBI Gene PubMed Count 33
Grant Count 7
R01 Count 7
Funding $1,438,678.68
PubMed Score 42.27
PubTator Score 40.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
medulloblastoma -4.400 0.000
atypical teratoid / rhabdoid tumor -4.100 0.000
glioblastoma -1.900 0.005
medulloblastoma, large-cell -4.300 0.000
primitive neuroectodermal tumor -2.500 0.010
breast carcinoma -1.400 0.001
fibroadenoma -1.700 0.046
pediatric high grade glioma -1.300 0.009
ductal carcinoma in situ -2.200 0.000
invasive ductal carcinoma -2.300 0.002
psoriasis -1.600 0.000

Gene RIF (30)

PMID Text
26677113 Due to the ability to reactivate expression of hepaCAM and inhibit growth of bladder cancer cells, AZAC may represent an effective treatment for bladder cancer.
26033718 The extracellular domain of GlialCAM is necessary for cell junction targeting and for mediating interactions with itself or with MLC1 and ClC-2.
25185546 GlialCAM is able to interact with all CLC channels tested in this study, targeting them to cell junctions and activating them by stabilizing the open configuration of the common gate
25044933 Results allow classifying the effect of HEPACAM gene mutations in different subtypes and authors indicate different cellular mechanisms that lead to megalencephalic leukoencephalopathy pathogenesis.
24824219 we demonstrate an evolutionary conserved role for MLC1 in regulating glial surface levels of GLIALCAM, and this interrelationship explains why patients with mutations in either gene (MLC1 or GLIALCAM) share the same clinical phenotype.
24811146 results suggested that HepaCAM acted as a tumor suppressor in prostate cancer
24645843 High expression of hepaCAM is associated with renal carcinoma.
24580998 No clear association between GLIALCAM mutations and an autism-epilepsy phenotype.
24515280 HepaCAM may prevent the translocation of PKCepsilon from cytosolic to particulate fractions, resulting in the inhibition of 786-0 cell proliferation.
24324362 Re-activation of hepaCAM gene by 5-aza-CdR can inhibit growth of cancer cells and arrest cells at G0/G1 phase
More...

AA Sequence

MKRERGALSRASRALRLAPFVYLLLIQTDPLEGVNITSPVRLIHGTVGKSALLSVQYSSTSSDRPVVKWQ      1 - 70
LKRDKPVTVVQSIGTEVIGTLRPDYRDRIRLFENGSLLLSDLQLADEGTYEVEISITDDTFTGEKTINLT     71 - 140
VDVPISRPQVLVASTTVLELSEAFTLNCSHENGTKPSYTWLKDGKPLLNDSRMLLSPDQKVLTITRVLME    141 - 210
DDDLYSCMVENPISQGRSLPVKITVYRRSSLYIILSTGGIFLLVTLVTVCACWKPSKRKQKKLEKQNSLE    211 - 280
YMDQNDDRLKPEADTLPRSGEQERKNPMALYILKDKDSPETEENPAPEPRSATEPGPPGYSVSPAVPGRS    281 - 350
PGLPIRSARRYPRSPARSPATGRTHSSPPRAPSSPGRSRSASRTLRTAGVHIIREQDEAGPVEISA        351 - 416
//

Text Mined References (36)

PMID Year Title
26677113 2016 5-azacytidine inhibits the proliferation of bladder cancer cells via reversal of the aberrant hypermethylation of the hepaCAM gene.
26033718 2015 Structural determinants of interaction, trafficking and function in the ClC-2/MLC1 subunit GlialCAM involved in leukodystrophy.
25185546 2014 GlialCAM, a CLC-2 Cl(-) channel subunit, activates the slow gate of CLC chloride channels.
25044933 2014 Functional analyses of mutations in HEPACAM causing megalencephalic leukoencephalopathy.
24824219 2014 Megalencephalic leukoencephalopathy with subcortical cysts protein 1 regulates glial surface localization of GLIALCAM from fish to humans.
24811146 2014 Overexpression of HepaCAM inhibits cell viability and motility through suppressing nucleus translocation of androgen receptor and ERK signaling in prostate cancer.
24645843 2014 Renal tumor-derived exosomes inhibit hepaCAM expression of renal carcinoma cells in a p-AKT-dependent manner.
24580998 2014 Autism-epilepsy phenotype with macrocephaly suggests PTEN, but not GLIALCAM, genetic screening.
24515280 2014 HepaCAM inhibits clear cell renal carcinoma 786-0 cell proliferation via blocking PKC? translocation from cytoplasm to plasma membrane.
24324362 2013 Identification of hypermethylation in hepatocyte cell adhesion molecule gene promoter region in bladder carcinoma.
More...