Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.32
PubTator Score 0.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.400 1.2e-04
aldosterone-producing adenoma -1.238 4.9e-02
group 4 medulloblastoma 1.200 2.2e-03
invasive ductal carcinoma -1.256 2.7e-02
medulloblastoma, large-cell -1.500 1.6e-05
osteosarcoma 1.568 1.3e-03
ovarian cancer -1.100 1.3e-02
pancreatic cancer 1.100 9.7e-03
primary pancreatic ductal adenocarcinoma 1.105 1.1e-02
spina bifida -1.645 3.7e-02
tuberculosis -1.200 2.4e-06

Synonym

Accession Q14CZ0
Symbols PRO0149

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (2)

AA Sequence

MEERKEEGEAEIQEHGPEHWFSKWERQCLAEAEQDEQLPPELQEEAAAAAQPEHKQQKLWHLFQNSATAV      1 - 70
AQLYKDRVCQQPGLSLWVPFQNAATAVTNLYKESVDTHQRSFDIGIQIGYQRRNKDVLAWVKKRRRTIRR     71 - 140
EDLISFLCGKVPPPRNSRAPPRLTVVSPNRATSTETSSSVETDLQPFREAIALHGLSGAMASISVRSSTP    141 - 210
GSPTHVSSGSNASRRRNGLHDVDLNTFISEEMALHLDNGGTRKRTSAQCGDVITDSPTHKRNRMI         211 - 275
//

Text Mined References (8)

PMID Year Title