Property Summary

NCBI Gene PubMed Count 18
Grant Count 3
R01 Count 3
Funding $372,984
PubMed Score 11.24
PubTator Score 3.36

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q14CX7 A0JLU7 Q6MZH1 Q7Z4N6 Q9H911
Symbols NAP1
MDM20
C12orf30

Gene

PANTHER Protein Class (2)

Gene RIF (10)

PMID Text
26600389 Mdm20 acts as a novel regulator of Rictor, thereby controlling mTORC2 activity, and leading to the activation of PKCalphaS657 and FoxO1.
22814378 The human NatB complex composed of Naa20 (NAT3) and Naa25 (MDM20) N-terminally acetylates Met-Glu-, Met-Asp-, Met-Asn- and Met-Gln- N-termini, and is important for the structure and function of actomyosin fibers and for proper cellular migration.
20962850 Observational study of gene-disease association. (HuGE Navigator)
20549515 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20203524 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20089178 The C120rf30 gene maps into a region of extensive linkage disequilibrium including several genes that represent functional candidates of type 1 diabetes-susceptibility.
19565500 There are associations between juvenile idiopathic arthritis and variants in the TNFAIP3, STAT4, and C12orf30 regions that have previously shown associations with other autoimmune diseases, including rheumatoid arthritis and systemic lupus erythematosus.
19565500 Observational study of gene-disease association. (HuGE Navigator)
18570629 Human N-acetyltransferase complexe NatB consists of human N-acetyltransferase 3 and human MDM20. The hMDM20 knockdown decreased the fraction of cells in G(0)/G(1)-phase and increased the fraction of cells in the sub-G(0)/G(1)-phase.
18570629 hMdm20 (C12orf30) is an auxiliary subunit of the human NatB N-terminal acetyltransferase complex while hNat3 (NAT5) is the catalytic subunit. This ribosome associated complex acetylates nascent Met-Asp/Glu- polypeptides.

AA Sequence

MATRGHVQDPNDRRLRPIYDYLDNGNNKMAIQQADKLLKKHKDLHCAKVLKAIGLQRTGKQEEAFTLAQE      1 - 70
VAALEPTDDNSLQALTILYREMHRPELVTKLYEAAVKKVPNSEEYHSHLFMAYARVGEYKKMQQAGMALY     71 - 140
KIVPKNPYYFWSVMSLIMQSISAQDENLSKTMFLPLAERMVEKMVKEDKIEAEAEVELYYMILERLGKYQ    141 - 210
EALDVIRGKLGEKLTSEIQSRENKCMAMYKKLSRWPECNALSRRLLLKNSDDWQFYLTYFDSVFRLIEEA    211 - 280
WSPPAEGEHSLEGEVHYSAEKAVKFIEDRITEESKSSRHLRGPHLAKLELIRRLRSQGCNDEYKLGDPEE    281 - 350
LMFQYFKKFGDKPCCFTDLKVFVDLLPATQCTKFINQLLGVVPLSTPTEDKLALPADIRALQQHLCVVQL    351 - 420
TRLLGLYHTMDKNQKLSVVRELMLRYQHGLEFGKTCLKTELQFSDYYCLLAVHALIDVWRETGDETTVWQ    421 - 490
ALTLLEEGLTHSPSNAQFKLLLVRIYCMLGAFEPVVDLYSSLDAKHIQHDTIGYLLTRYAESLGQYAAAS    491 - 560
QSCNFALRFFHSNQKDTSEYIIQAYKYGAFEKIPEFIAFRNRLNNSLHFAQVRTERMLLDLLLEANISTS    561 - 630
LAESIKSMNLRPEEDDIPWEDLRDNRDLNVFFSWDPKDRDVSEEHKKLSLEEETLWLRIRSLTLRLISGL    631 - 700
PSLNHPVEPKNSEKTAENGVSSRIDILRLLLQQLEATLETGKRFIEKDIQYPFLGPVPTRMGGFFNSGCS    701 - 770
QCQISSFYLVNDIYELDTSGLEDTMEIQERIENSFKSLLDQLKDVFSKCKGDLLEVKDGNLKTHPTLLEN    771 - 840
LVFFVETISVILWVSSYCESVLRPYKLNLQKKKKKKKETSIIMPPVFTSFQDYVTGLQTLISNVVDHIKG    841 - 910
LETHLIALKLEELILEDTSLSPEERKFSKTVQGKVQSSYLHSLLEMGELLKKRLETTKKLKI            911 - 972
//

Text Mined References (22)

PMID Year Title
26600389 2015 Mdm20 Modulates Actin Remodeling through the mTORC2 Pathway via Its Effect on Rictor Expression.
24262325 2014 Shared genetic susceptibility to ischemic stroke and coronary artery disease: a genome-wide analysis of common variants.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22493691 2012 Novel associations for hypothyroidism include known autoimmune risk loci.
21437268 2011 A genome-wide association study of upper aerodigestive tract cancers conducted within the INHANCE consortium.
21269460 2011 Initial characterization of the human central proteome.
20962850 2011 A targeted association study in systemic lupus erythematosus identifies multiple susceptibility alleles.
20549515 2010 Genome-wide searching of rare genetic variants in WTCCC data.
20203524 2010 Genetic susceptibility to type 2 diabetes is associated with reduced prostate cancer risk.
20089178 2010 Allelic variants in the PHTF1-PTPN22, C12orf30 and CD226 regions as candidate susceptibility factors for the type 1 diabetes in the Estonian population.
More...