Property Summary

NCBI Gene PubMed Count 11
PubMed Score 5.56
PubTator Score 10.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 3.0e-09
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Pachyonychia congenita 10 3.434 1.7

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.100 3.0e-09

Gene RIF (3)

AA Sequence

MSRQLTHFPRGERLGFSGCSAVLSGGIGSSSASFRARVKGSASFGSKSLSCLGGSRSLALSAAARRGGGR      1 - 70
LGGFVGTAFGSAGLGPKCPSVCPPGGIPQVTVNKSLLAPLNVEMDPEIQRVRAQEREQIKALNNKFASFI     71 - 140
DKVRFLEQQNQVLETKWNLLQQLDLNNCRKNLEPIYEGYISNLQKQLEMLSGDGVRLDSELRNMQDLVED    141 - 210
YKKRYEVEINRRTAAENEFVVLKKDVDAAYMNKVELQAKVDSLTDEIKFFKCLYEGEITQIQSHISDTSI    211 - 280
VLSMDNNRDLDLDSIIAEVRAQYEEIALKSKAEAETLYQTKIQELQVTAGQHGDDLKLTKAEISELNRLI    281 - 350
QRIRSEIGNVKKQCADLETAIADAEQRGDCALKDARAKLDELEGALHQAKEELARMLREYQELVSLKLAL    351 - 420
DMEIATYRKLLESEECRMSGEYPNSVSISVISSTNAGAGGAGFSMGFGASSSYSYKTAAADVKTKGSCGS    421 - 490
ELKDPLAKTSGSSCATKKASR                                                     491 - 511
//

Text Mined References (14)

PMID Year Title