Property Summary

NCBI Gene PubMed Count 10
PubMed Score 77.76
PubTator Score 9.94

Knowledge Summary

Patent (12,925)

Expression

  Differential Expression (14)

Disease log2 FC p
cystic fibrosis 2.700 1.2e-03
Breast cancer -2.700 8.5e-70
chronic rhinosinusitis 1.869 1.2e-02
colon cancer -2.400 6.2e-03
Down syndrome 1.100 3.3e-03
ependymoma -2.400 4.5e-02
esophageal adenocarcinoma -4.100 2.3e-02
glioblastoma multiforme -1.100 2.4e-08
interstitial cystitis -4.100 8.7e-03
nasopharyngeal carcinoma -2.900 2.7e-04
non-small cell lung cancer 1.318 1.4e-04
oligodendroglioma -1.100 1.3e-06
progressive supranuclear palsy -1.800 1.2e-02
spina bifida -1.391 4.3e-02

Gene RIF (5)

AA Sequence

MGLFRGFVFLLVLCLLHQSNTSFIKLNNNGFEDIVIVIDPSVPEDEKIIEQIEDMVTTASTYLFEATEKR      1 - 70
FFFKNVSILIPENWKENPQYKRPKHENHKHADVIVAPPTLPGRDEPYTKQFTECGEKGEYIHFTPDLLLG     71 - 140
KKQNEYGPPGKLFVHEWAHLRWGVFDEYNEDQPFYRAKSKKIEATRCSAGISGRNRVYKCQGGSCLSRAC    141 - 210
RIDSTTKLYGKDCQFFPDKVQTEKASIMFMQSIDSVVEFCNEKTHNQEAPSLQNIKCNFRSTWEVISNSE    211 - 280
DFKNTIPMVTPPPPPVFSLLKISQRIVCLVLDKSGSMGGKDRLNRMNQAAKHFLLQTVENGSWVGMVHFD    281 - 350
STATIVNKLIQIKSSDERNTLMAGLPTYPLGGTSICSGIKYAFQVIGELHSQLDGSEVLLLTDGEDNTAS    351 - 420
SCIDEVKQSGAIVHFIALGRAADEAVIEMSKITGGSHFYVSDEAQNNGLIDAFGALTSGNTDLSQKSLQL    421 - 490
ESKGLTLNSNAWMNDTVIIDSTVGKDTFFLITWNSLPPSISLWDPSGTIMENFTVDATSKMAYLSIPGTA    491 - 560
KVGTWAYNLQAKANPETLTITVTSRAANSSVPPITVNAKMNKDVNSFPSPMIVYAEILQGYVPVLGANVT    561 - 630
AFIESQNGHTEVLELLDNGAGADSFKNDGVYSRYFTAYTENGRYSLKVRAHGGANTARLKLRPPLNRAAY    631 - 700
IPGWVVNGEIEANPPRPEIDEDTQTTLEDFSRTASGGAFVVSQVPSLPLPDQYPPSQITDLDATVHEDKI    701 - 770
ILTWTAPGDNFDVGKVQRYIIRISASILDLRDSFDDALQVNTTDLSPKEANSKESFAFKPENISEENATH    771 - 840
IFIAIKSIDKSNLTSKVSNIAQVTLFIPQANPDDIDPTPTPTPTPTPDKSHNSGVNISTLVLSVIGSVVI    841 - 910
VNFILSTTI                                                                 911 - 919
//

Text Mined References (16)

PMID Year Title