Property Summary

NCBI Gene PubMed Count 10
PubMed Score 71.74
PubTator Score 9.94

Knowledge Summary

Patent (12,925)

Expression

  Differential Expression (14)

Disease log2 FC p
cystic fibrosis 2.700 0.001
ependymoma -2.400 0.045
esophageal adenocarcinoma -4.100 0.023
glioblastoma multiforme -1.100 0.000
oligodendroglioma -1.100 0.000
non-small cell lung cancer 1.318 0.000
colon cancer -4.700 0.001
interstitial cystitis -4.100 0.009
nasopharyngeal carcinoma -2.900 0.000
spina bifida -1.391 0.043
progressive supranuclear palsy -1.800 0.012
Breast cancer -2.700 0.000
Down syndrome 1.100 0.003
chronic rhinosinusitis 1.869 0.012

Synonym

Accession Q14CN2 A8MQC9 B7Z1Q5 Q6UX81 Q9UNF7
Symbols CaCC
CaCC2

Gene

PANTHER Protein Class (2)

Gene RIF (5)

PMID Text
24386311 CLCA4 and CLCA2 play complementary but distinct roles in epithelial differentiation
23073314 CLCA4 modulates the capability to express residual chloride secretion in colonic tissue.
19460752 Knockdown of chloride channel accessory 4 (CLCA4) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
15490240 CLCA1 and CLCA4 may have roles as modulators of the gastrointestinal basic defect in cystic fibrosis
10758170 HIV-1 gp120 from both CCR5- and CXCR4-tropic HIV-1 strains opens calcium-activated potassium (K(Ca)), chloride, and calcium-permeant nonselective cation channels in macrophages; these signals are mediated by CCR5 and CXCR4

AA Sequence

MGLFRGFVFLLVLCLLHQSNTSFIKLNNNGFEDIVIVIDPSVPEDEKIIEQIEDMVTTASTYLFEATEKR      1 - 70
FFFKNVSILIPENWKENPQYKRPKHENHKHADVIVAPPTLPGRDEPYTKQFTECGEKGEYIHFTPDLLLG     71 - 140
KKQNEYGPPGKLFVHEWAHLRWGVFDEYNEDQPFYRAKSKKIEATRCSAGISGRNRVYKCQGGSCLSRAC    141 - 210
RIDSTTKLYGKDCQFFPDKVQTEKASIMFMQSIDSVVEFCNEKTHNQEAPSLQNIKCNFRSTWEVISNSE    211 - 280
DFKNTIPMVTPPPPPVFSLLKISQRIVCLVLDKSGSMGGKDRLNRMNQAAKHFLLQTVENGSWVGMVHFD    281 - 350
STATIVNKLIQIKSSDERNTLMAGLPTYPLGGTSICSGIKYAFQVIGELHSQLDGSEVLLLTDGEDNTAS    351 - 420
SCIDEVKQSGAIVHFIALGRAADEAVIEMSKITGGSHFYVSDEAQNNGLIDAFGALTSGNTDLSQKSLQL    421 - 490
ESKGLTLNSNAWMNDTVIIDSTVGKDTFFLITWNSLPPSISLWDPSGTIMENFTVDATSKMAYLSIPGTA    491 - 560
KVGTWAYNLQAKANPETLTITVTSRAANSSVPPITVNAKMNKDVNSFPSPMIVYAEILQGYVPVLGANVT    561 - 630
AFIESQNGHTEVLELLDNGAGADSFKNDGVYSRYFTAYTENGRYSLKVRAHGGANTARLKLRPPLNRAAY    631 - 700
IPGWVVNGEIEANPPRPEIDEDTQTTLEDFSRTASGGAFVVSQVPSLPLPDQYPPSQITDLDATVHEDKI    701 - 770
ILTWTAPGDNFDVGKVQRYIIRISASILDLRDSFDDALQVNTTDLSPKEANSKESFAFKPENISEENATH    771 - 840
IFIAIKSIDKSNLTSKVSNIAQVTLFIPQANPDDIDPTPTPTPTPTPDKSHNSGVNISTLVLSVIGSVVI    841 - 910
VNFILSTTI                                                                 911 - 919
//

Text Mined References (16)

PMID Year Title
24386311 2013 Loss of CLCA4 promotes epithelial-to-mesenchymal transition in breast cancer cells.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23073314 2013 CLCA4 variants determine the manifestation of the cystic fibrosis basic defect in the intestine.
18254958 2008 Transcriptomic dissection of tongue squamous cell carcinoma.
16740002 2006 Identification of N-linked glycoproteins in human saliva by glycoprotein capture and mass spectrometry.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16012037 2005 Expression and distribution of ion transport mRNAs in human nasal mucosa and nasal polyps.
15490240 2004 The CLCA gene locus as a modulator of the gastrointestinal basic defect in cystic fibrosis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...