Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.97
PubTator Score 2.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (6)

Disease log2 FC p
Breast cancer -1.100 3.1e-16
group 3 medulloblastoma 1.100 1.3e-02
malignant mesothelioma 2.000 3.5e-08
osteosarcoma -2.259 6.8e-05
ovarian cancer -1.400 1.2e-07
primitive neuroectodermal tumor 1.300 2.1e-03

Gene RIF (2)

AA Sequence

MATEAQSEGEVPARESGRSDAICSFVICNDSSLRGQPIIFNPDFFVEKLRHEKPEIFTELVVSNITRLID      1 - 70
LPGTELAQLMGEVDLKLPGGAGPASGFFRSLMSLKRKEKGVIFGSPLTEEGIAQIYQLIEYLHKNLRVEG     71 - 140
LFRVPGNSVRQQILRDALNNGTDIDLESGEFHSNDVATLLKMFLGELPEPLLTHKHFNAHLKIADLMQFD    141 - 210
DKGNKTNIPDKDRQIEALQLLFLILPPPNRNLLKLLLDLLYQTAKKQDKNKMSAYNLALMFAPHVLWPKN    211 - 280
VTANDLQENITKLNSGMAFMIKHSQKLFKAPAYIRECARLHYLGSRTQASKDDLDLIASCHTKSFQLAKS    281 - 350
QKRNRVDSCPHQEETQHHTEEALRELFQHVHDMPESAKKKQLIRQFNKQSLTQTPGREPSTSQVQKRARS    351 - 420
RSFSGLIKRKVLGNQMMSEKKKKNPTPESVAIGELKGTSKENRNLLFSGSPAVTMTPTRLKWSEGKKEGK    421 - 490
KGFL                                                                      491 - 494
//

Text Mined References (15)

PMID Year Title