Property Summary

NCBI Gene PubMed Count 24
PubMed Score 19.12
PubTator Score 10.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
aldosterone-producing adenoma -1.256 3.5e-02
atypical teratoid / rhabdoid tumor -1.300 5.6e-04
Breast cancer -1.100 3.6e-13
glioblastoma -1.500 1.9e-05
hereditary spastic paraplegia -1.269 5.1e-03
intraductal papillary-mucinous neoplasm ... 1.600 3.4e-02
medulloblastoma -1.500 2.6e-05
medulloblastoma, large-cell -1.700 2.6e-04
osteosarcoma -1.859 3.8e-03
ovarian cancer -1.100 1.5e-06
pancreatic cancer 1.400 6.5e-03
primary pancreatic ductal adenocarcinoma 1.354 2.5e-03
primitive neuroectodermal tumor -1.200 9.1e-04
Rheumatoid arthritis 1.200 2.1e-02
spina bifida -1.029 4.3e-02
tuberculosis and treatment for 6 months 1.200 2.6e-05

Gene RIF (2)

AA Sequence

MPSALAIFTCRPNSHPFQERHVYLDEPIKIGRSVARCRPAQNNATFDCKVLSRNHALVWFDHKTGKFYLQ      1 - 70
DTKSSNGTFINSQRLSRGSEESPPCEILSGDIIQFGVDVTENTRKVTHGCIVSTIKLFLPDGMEARLRSD     71 - 140
VIHAPLPSPVDKVAANTPSMYSQELFQLSQYLQEALHREQMLEQKLATLQRLLAITQEASDTSWQALIDE    141 - 210
DRLLSRLEVMGNQLQACSKNQTEDSLRKELIALQEDKHNYETTAKESLRRVLQEKIEVVRKLSEVERSLS    211 - 280
NTEDECTHLKEMNERTQEELRELANKYNGAVNEIKDLSDKLKVAEGKQEEIQQKGQAEKKELQHKIDEME    281 - 350
EKEQELQAKIEALQADNDFTNERLTALQVRLEHLQEKTLKECSSLEHLLSKSGGDCTFIHQFIECQKKLI    351 - 420
VEGHLTKAVEETKLSKENQTRAKESDFSDTLSPSKEKSSDDTTDAQMDEQDLNEPLAKVSLLKDDLQGAQ    421 - 490
SEIEAKQEIQHLRKELIEAQELARTSKQKCFELQALLEEERKAYRNQVEESTKQIQVLQAQLQRLHIDTE    491 - 560
NLREEKDSEITSTRDELLSARDEILLLHQAAAKVASERDTDIASLQEELKKVRAELERWRKAASEYEKEI    561 - 630
TSLQNSFQLRCQQCEDQQREEATRLQGELEKLRKEWNALETECHSLKRENVLLSSELQRQEKELHNSQKQ    631 - 700
SLELTSDLSILQMSRKELENQVGSLKEQHLRDSADLKTLLSKAENQAKDVQKEYEKTQTVLSELKLKFEM    701 - 770
TEQEKQSITDELKQCKNNLKLLREKGNNKPWPWMPMLAALVAVTAIVLYVPGLARASP                771 - 828
//

Text Mined References (28)

PMID Year Title