Property Summary

NCBI Gene PubMed Count 12
Grant Count 10
R01 Count 10
Funding $1,805,023.5
PubMed Score 39.27
PubTator Score 18.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
malignant mesothelioma 1.400 0.000
psoriasis -1.700 0.000
osteosarcoma 2.090 0.000
glioblastoma 1.700 0.005
group 4 medulloblastoma 1.200 0.001
medulloblastoma, large-cell 1.600 0.000
tuberculosis -1.400 0.000
non-small cell lung cancer 1.090 0.000
intraductal papillary-mucinous adenoma (... 1.500 0.000
intraductal papillary-mucinous carcinoma... 1.400 0.002
intraductal papillary-mucinous neoplasm ... 1.200 0.014
lung cancer 1.500 0.000
COPD -1.100 0.027
Pick disease -1.800 0.000
progressive supranuclear palsy -1.800 0.006
Breast cancer -1.100 0.000
gastric carcinoma 1.200 0.031
invasive ductal carcinoma 1.300 0.020
ulcerative colitis 1.200 0.000
ovarian cancer 2.100 0.000
sarcoidosis 1.200 0.022

Gene RIF (29)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
14614829 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
14564014 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
14557625 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
14550573 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
14550573 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
14528301 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
14528300 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
14527406 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
12970355 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
More...

AA Sequence

MEPAERAGVGEPPEPGGRPEPGPRGFVPQKEIVYNKLLPYAERLDAESDLQLAQIKCNLGRAVQLQELWP      1 - 70
GGLFWTRKLSTYIRLYGRKFSKEDHVLFIKLLYELVSIPKLEISMMQGFARLLINLLKKKELLSRADLEL     71 - 140
PWRPLYDMVERILYSKTEHLGLNWFPNSVENILKTLVKSCRPYFPADATAEMLEEWRPLMCPFDVTMQKA    141 - 210
ITYFEIFLPTSLPPELHHKGFKLWFDELIGLWVSVQNLPQWEGQLVNLFARLATDNIGYIDWDPYVPKIF    211 - 280
TRILRSLNLPVGSSQVLVPRFLTNAYDIGHAVIWITAMMGGPSKLVQKHLAGLFNSITSFYHPSNNGRWL    281 - 350
NKLMKLLQRLPNSVVRRLHRERYKKPSWLTPVPDSHKLTDQDVTDFVQCIIQPVLLAMFSKTGSLEAAQA    351 - 420
LQNLALMRPELVIPPVLERTYPALETLTEPHQLTATLSCVIGVARSLVSGGRWFPEGPTHMLPLLMRALP    421 - 490
GVDPNDFSKCMITFQFIATFSTLVPLVDCSSVLQERNDLTEVERELCSATAEFEDFVLQFMDRCFGLIES    491 - 560
STLEQTREETETEKMTHLESLVELGLSSTFSTILTQCSKEIFMVALQKVFNFSTSHIFETRVAGRMVADM    561 - 630
CRAAVKCCPEESLKLFVPHCCSVITQLTMNDDVLNDEELDKELLWNLQLLSEITRVDGRKLLLYREQLVK    631 - 700
ILQRTLHLTCKQGYTLSCNLLHHLLRSTTLIYPTEYCSVPGGFDKPPSEYFPIKDWGKPGDLWNLGIQWH    701 - 770
VPSSEEVSFAFYLLDSFLQPELVKLQHCGDGKLEMSRDDILQSLTIVHNCLIGSGNLLPPLKGEPVTNLV    771 - 840
PSMVSLEETKLYTGLEYDLSRENHREVIATVIRKLLNHILDNSEDDTKSLFLIIKIIGDLLQFQGSHKHE    841 - 910
FDSRWKSFNLVKKSMENRLHGKKQHIRALLIDRVMLQHELRTLTVEGCEYKKIHQDMIRDLLRLSTSSYS    911 - 980
QVRNKAQQTFFAALGAYNFCCRDIIPLVLEFLRPDRQGVTQQQFKGALYCLLGNHSGVCLANLHDWDCIV    981 - 1050
QTWPAIVSSGLSQAMSLEKPSIVRLFDDLAEKIHRQYETIGLDFTIPKSCVEIAELLQQSKNPSINQILL   1051 - 1120
SPEKIKEGIKRQQEKNADALRNYENLVDTLLDGVEQRNLPWKFEHIGIGLLSLLLRDDRVLPLRAIRFFV   1121 - 1190
ENLNHDAIVVRKMAISAVAGILKQLKRTHKKLTINPCEISGCPKPTQIIAGDRPDNHWLHYDSKTIPRTK   1191 - 1260
KEWESSCFVEKTHWGYYTWPKNMVVYAGVEEQPKLGRSREDMTEAEQIIFDHFSDPKFVEQLITFLSLED   1261 - 1330
RKGKDKFNPRRFCLFKGIFRNFDDAFLPVLKPHLEHLVADSHESTQRCVAEIIAGLIRGSKHWTFEKVEK   1331 - 1400
LWELLCPLLRTALSNITVETYNDWGACIATSCESRDPRKLHWLFELLLESPLSGEGGSFVDACRLYVLQG   1401 - 1470
GLAQQEWRVPELLHRLLKYLEPKLTQVYKNVRERIGSVLTYIFMIDVSLPNTTPTISPHVPEFTARILEK   1471 - 1540
LKPLMDVDEEIQNHVMEENGIGEEDERTQGIKLLKTILKWLMASAGRSFSTAVTEQLQLLPLFFKIAPVE   1541 - 1610
NDNSYDELKRDAKLCLSLMSQGLLYPHQVPLVLQVLKQTARSSSWHARYTVLTYLQTMVFYNLFIFLNNE   1611 - 1680
DAVKDIRWLVISLLEDEQLEVREMAATTLSGLLQCNFLTMDSPMQIHFEQLCKTKLPKKRKRDPGSVGDT   1681 - 1750
IPSAELVKRHAGVLGLGACVLSSPYDVPTWMPQLLMNLSAHLNDPQPIEMTVKKTLSNFRRTHHDNWQEH   1751 - 1820
KQQFTDDQLLVLTDLLVSPCYYA                                                  1821 - 1843
//

Publication (19)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23706739 2013 Acetylation-mediated proteasomal degradation of core histones during DNA repair and spermatogenesis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22550082 2012 The proteasome activator PA200 regulates tumor cell responsiveness to glutamine and resistance to ionizing radiation.
21697133 2011 Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18845680 2008 Role for proteasome activator PA200 and postglutamyl proteasome activity in genomic stability.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...