Property Summary

NCBI Gene PubMed Count 12
PubMed Score 39.33
PubTator Score 18.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
Breast cancer -1.100 9.7e-13
COPD -1.100 2.7e-02
gastric carcinoma 1.200 3.1e-02
glioblastoma 1.700 4.5e-03
group 3 medulloblastoma 1.100 3.9e-03
intraductal papillary-mucinous adenoma (... 1.500 4.8e-04
intraductal papillary-mucinous carcinoma... 1.400 1.6e-03
intraductal papillary-mucinous neoplasm ... 1.200 1.4e-02
invasive ductal carcinoma 1.300 2.0e-02
lung cancer 1.500 1.5e-04
malignant mesothelioma 1.400 9.9e-07
medulloblastoma, large-cell 1.500 1.8e-04
non-small cell lung cancer 1.090 1.4e-16
osteosarcoma -1.549 3.5e-04
ovarian cancer 2.100 2.1e-05
Pick disease -1.800 6.8e-06
progressive supranuclear palsy -1.800 6.5e-03
psoriasis -1.200 2.7e-03
sarcoidosis 1.200 2.2e-02
tuberculosis -1.400 4.4e-07
ulcerative colitis 1.200 2.9e-06

 GWAS Trait (1)

Gene RIF (26)

AA Sequence

MEPAERAGVGEPPEPGGRPEPGPRGFVPQKEIVYNKLLPYAERLDAESDLQLAQIKCNLGRAVQLQELWP      1 - 70
GGLFWTRKLSTYIRLYGRKFSKEDHVLFIKLLYELVSIPKLEISMMQGFARLLINLLKKKELLSRADLEL     71 - 140
PWRPLYDMVERILYSKTEHLGLNWFPNSVENILKTLVKSCRPYFPADATAEMLEEWRPLMCPFDVTMQKA    141 - 210
ITYFEIFLPTSLPPELHHKGFKLWFDELIGLWVSVQNLPQWEGQLVNLFARLATDNIGYIDWDPYVPKIF    211 - 280
TRILRSLNLPVGSSQVLVPRFLTNAYDIGHAVIWITAMMGGPSKLVQKHLAGLFNSITSFYHPSNNGRWL    281 - 350
NKLMKLLQRLPNSVVRRLHRERYKKPSWLTPVPDSHKLTDQDVTDFVQCIIQPVLLAMFSKTGSLEAAQA    351 - 420
LQNLALMRPELVIPPVLERTYPALETLTEPHQLTATLSCVIGVARSLVSGGRWFPEGPTHMLPLLMRALP    421 - 490
GVDPNDFSKCMITFQFIATFSTLVPLVDCSSVLQERNDLTEVERELCSATAEFEDFVLQFMDRCFGLIES    491 - 560
STLEQTREETETEKMTHLESLVELGLSSTFSTILTQCSKEIFMVALQKVFNFSTSHIFETRVAGRMVADM    561 - 630
CRAAVKCCPEESLKLFVPHCCSVITQLTMNDDVLNDEELDKELLWNLQLLSEITRVDGRKLLLYREQLVK    631 - 700
ILQRTLHLTCKQGYTLSCNLLHHLLRSTTLIYPTEYCSVPGGFDKPPSEYFPIKDWGKPGDLWNLGIQWH    701 - 770
VPSSEEVSFAFYLLDSFLQPELVKLQHCGDGKLEMSRDDILQSLTIVHNCLIGSGNLLPPLKGEPVTNLV    771 - 840
PSMVSLEETKLYTGLEYDLSRENHREVIATVIRKLLNHILDNSEDDTKSLFLIIKIIGDLLQFQGSHKHE    841 - 910
FDSRWKSFNLVKKSMENRLHGKKQHIRALLIDRVMLQHELRTLTVEGCEYKKIHQDMIRDLLRLSTSSYS    911 - 980
QVRNKAQQTFFAALGAYNFCCRDIIPLVLEFLRPDRQGVTQQQFKGALYCLLGNHSGVCLANLHDWDCIV    981 - 1050
QTWPAIVSSGLSQAMSLEKPSIVRLFDDLAEKIHRQYETIGLDFTIPKSCVEIAELLQQSKNPSINQILL   1051 - 1120
SPEKIKEGIKRQQEKNADALRNYENLVDTLLDGVEQRNLPWKFEHIGIGLLSLLLRDDRVLPLRAIRFFV   1121 - 1190
ENLNHDAIVVRKMAISAVAGILKQLKRTHKKLTINPCEISGCPKPTQIIAGDRPDNHWLHYDSKTIPRTK   1191 - 1260
KEWESSCFVEKTHWGYYTWPKNMVVYAGVEEQPKLGRSREDMTEAEQIIFDHFSDPKFVEQLITFLSLED   1261 - 1330
RKGKDKFNPRRFCLFKGIFRNFDDAFLPVLKPHLEHLVADSHESTQRCVAEIIAGLIRGSKHWTFEKVEK   1331 - 1400
LWELLCPLLRTALSNITVETYNDWGACIATSCESRDPRKLHWLFELLLESPLSGEGGSFVDACRLYVLQG   1401 - 1470
GLAQQEWRVPELLHRLLKYLEPKLTQVYKNVRERIGSVLTYIFMIDVSLPNTTPTISPHVPEFTARILEK   1471 - 1540
LKPLMDVDEEIQNHVMEENGIGEEDERTQGIKLLKTILKWLMASAGRSFSTAVTEQLQLLPLFFKIAPVE   1541 - 1610
NDNSYDELKRDAKLCLSLMSQGLLYPHQVPLVLQVLKQTARSSSWHARYTVLTYLQTMVFYNLFIFLNNE   1611 - 1680
DAVKDIRWLVISLLEDEQLEVREMAATTLSGLLQCNFLTMDSPMQIHFEQLCKTKLPKKRKRDPGSVGDT   1681 - 1750
IPSAELVKRHAGVLGLGACVLSSPYDVPTWMPQLLMNLSAHLNDPQPIEMTVKKTLSNFRRTHHDNWQEH   1751 - 1820
KQQFTDDQLLVLTDLLVSPCYYA                                                  1821 - 1843
//

Text Mined References (19)

PMID Year Title