Property Summary

NCBI Gene PubMed Count 25
Grant Count 10
R01 Count 10
Funding $1,060,836.01
PubMed Score 50.95
PubTator Score 96.37

Knowledge Summary

Patent (14,618)

Expression

  Differential Expression (25)

Disease log2 FC p
Rheumatoid Arthritis 2.700 0.002
pancreatic cancer -1.300 0.041
astrocytic glioma 1.200 0.033
oligodendroglioma 1.300 0.014
osteosarcoma 1.895 0.003
atypical teratoid / rhabdoid tumor -2.400 0.000
glioblastoma -1.700 0.000
medulloblastoma, large-cell -1.600 0.000
primitive neuroectodermal tumor -1.500 0.000
Crohn's disease -1.863 0.002
ulcerative colitis -2.185 0.001
Amyotrophic Lateral Sclerosis 1.219 0.000
adrenocortical carcinoma 1.343 0.001
chronic kidney disease 1.100 0.045
intraductal papillary-mucinous adenoma (... 1.600 0.010
Breast cancer 2.500 0.043
cystic fibrosis -1.500 0.000
adult high grade glioma -1.400 0.005
group 3 medulloblastoma -1.400 0.018
pancreatic carcinoma -1.300 0.041
invasive ductal carcinoma -2.100 0.000
breast carcinoma -1.100 0.000
Pick disease 1.900 0.000
ductal carcinoma in situ -1.100 0.003
ovarian cancer -1.700 0.000

Synonym

Accession Q14995 B2R8Q3 O00402 Q86XD4
Symbols RVR
BD73
EAR-1R

Gene

PDB

2V0V   2V7C   3CQV   4N73  

  TechDev Info (2)

Steve Finkbeiner Neuron specific phenotypes being screened
Jun Qin Signaling network evaluation of transcript factor crosstalk via catTRE/MS

 GO Component (2)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
2277 screening 14 / 0 / 0 Center Based Initiative to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors.
504934 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors

Gene RIF (10)

PMID Text
26670607 heme is involved in regulating the degradation of Rev-erbbeta in a manner consistent with its role in circadian rhythm maintenance
26616049 Together, the findings demonstrate an anti-inflammatory effect, downregulating of MMP-9 and CCL2 transcription, of astroglial REV-ERBs activation through HDAC3-dependent and HDAC3-independent mechanisms.
25023698 REV-ERBbeta plays a role in supporting cancer cell viability when autophagy is compromised.
24872411 Cobalt protoporphyrin IX (CoPP) and zinc protoporphyrin IX (ZnPP) are ligands that bind directly to the REV-ERBs. However, instead of mimicking the agonist action of heme, CoPP and ZnPP function as antagonists of REV-ERB function.
24173768 REV-ERB-ALPHA circadian gene variant associates with obesity in two independent populations: Mediterranean and North American.
22828941 Our results suggest that the REV-ERBalpha rs2071427 polymorphism modulates body fat mass in both adult and young people.
21123168 oxidative stress leads to oxidation of cysteine(s), thus releasing heme from Rev-erbbeta and altering its transcriptional activity.
20348464 Nuclear receptor rev-erb-{alpha} circadian gene variants have a role in response to lithium carbonate in bipolar affective disorder
18037887 heme regulation of REV-ERBs may link the control of metabolism and the mammalian clock
17996965 Rev-erbbeta modulates the apoCIII gene expression by recruiting different transcription co-activator or co-repressor.

AA Sequence

MEVNAGGVIAYISSSSSASSPASCHSEGSENSFQSSSSSVPSSPNSSNSDTNGNPKNGDLANIEGILKND      1 - 70
RIDCSMKTSKSSAPGMTKSHSGVTKFSGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQYKKC     71 - 140
LKNENCSIMRMNRNRCQQCRFKKCLSVGMSRDAVRFGRIPKREKQRMLIEMQSAMKTMMNSQFSGHLQND    141 - 210
TLVEHHEQTALPAQEQLRPKPQLEQENIKSSSPPSSDFAKEEVIGMVTRAHKDTFMYNQEQQENSAESMQ    211 - 280
PQRGERIPKNMEQYNLNHDHCGNGLSSHFPCSESQQHLNGQFKGRNIMHYPNGHAICIANGHCMNFSNAY    281 - 350
TQRVCDRVPIDGFSQNENKNSYLCNTGGRMHLVCPLSKSPYVDPHKSGHEIWEEFSMSFTPAVKEVVEFA    351 - 420
KRIPGFRDLSQHDQVNLLKAGTFEVLMVRFASLFDAKERTVTFLSGKKYSVDDLHSMGAGDLLNSMFEFS    421 - 490
EKLNALQLSDEEMSLFTAVVLVSADRSGIENVNSVEALQETLIRALRTLIMKNHPNEASIFTKLLLKLPD    491 - 560
LRSLNNMHSEELLAFKVHP                                                       561 - 579
//

Text Mined References (30)

PMID Year Title
26670607 2016 High Affinity Heme Binding to a Heme Regulatory Motif on the Nuclear Receptor Rev-erb? Leads to Its Degradation and Indirectly Regulates Its Interaction with Nuclear Receptor Corepressor.
26616049 2016 Stimulation of nuclear receptor REV-ERBs regulates tumor necrosis factor-induced expression of proinflammatory molecules in C6 astroglial cells.
25023698 2015 Dual inhibition of REV-ERB? and autophagy as a novel pharmacological approach to induce cytotoxicity in cancer cells.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24872411 2014 Structure of REV-ERB? ligand-binding domain bound to a porphyrin antagonist.
24173768 2014 REV-ERB-ALPHA circadian gene variant associates with obesity in two independent populations: Mediterranean and North American.
23555304 2013 Dynamic circadian protein-protein interaction networks predict temporal organization of cellular functions.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
22828941 2013 Impact of REV-ERB alpha gene polymorphisms on obesity phenotypes in adult and adolescent samples.
22682217 2012 REV-ERBs: more than the sum of the individual parts.
More...