Property Summary

NCBI Gene PubMed Count 25
PubMed Score 50.95
PubTator Score 96.37

Knowledge Summary

Patent (14,618)

TINX Plot

  Disease Sources (2)

Disease Target Count
Endometriosis 535
Disease Target Count P-value
breast carcinoma 1614 2.70139180662734E-9
glioblastoma 5572 5.75231103652868E-6
atypical teratoid / rhabdoid tumor 4369 6.6062187570942E-6
cystic fibrosis 1670 2.24370236237643E-5
ovarian cancer 8492 3.49662704328547E-5
primitive neuroectodermal tumor 3031 3.99630566450018E-5
Pick disease 1893 4.5585374965003E-5
Amyotrophic Lateral Sclerosis 432 1.35342771170062E-4
medulloblastoma, large-cell 6234 2.03667810192168E-4
invasive ductal carcinoma 2950 3.20820254019982E-4
ulcerative colitis 2087 8.44917112292493E-4
adrenocortical carcinoma 1427 0.00118315362279051
Rheumatoid Arthritis 1171 0.00165601887061592
Crohn's disease 304 0.00168363936163458
osteosarcoma 7933 0.00306229861204277
ductal carcinoma in situ 1745 0.00320184648460465
adult high grade glioma 2148 0.00458400212943466
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0101259206630974
oligodendroglioma 2849 0.0139378505875409
group 3 medulloblastoma 2254 0.018467032008047
astrocytic glioma 2241 0.0330285028984839
pancreatic cancer 2300 0.0411458829902632
pancreatic carcinoma 567 0.0411458829902632
Breast cancer 3099 0.0434019724903514
chronic kidney disease 90 0.0446843342941263

Expression

  Differential Expression (25)

Disease log2 FC p
Rheumatoid Arthritis 2.700 0.002
pancreatic cancer -1.300 0.041
astrocytic glioma 1.200 0.033
oligodendroglioma 1.300 0.014
osteosarcoma 1.895 0.003
atypical teratoid / rhabdoid tumor -2.400 0.000
glioblastoma -1.700 0.000
medulloblastoma, large-cell -1.600 0.000
primitive neuroectodermal tumor -1.500 0.000
Crohn's disease -1.863 0.002
ulcerative colitis -2.185 0.001
Amyotrophic Lateral Sclerosis 1.219 0.000
adrenocortical carcinoma 1.343 0.001
chronic kidney disease 1.100 0.045
intraductal papillary-mucinous adenoma (... 1.600 0.010
Breast cancer 2.500 0.043
cystic fibrosis -1.500 0.000
adult high grade glioma -1.400 0.005
group 3 medulloblastoma -1.400 0.018
pancreatic carcinoma -1.300 0.041
invasive ductal carcinoma -2.100 0.000
breast carcinoma -1.100 0.000
Pick disease 1.900 0.000
ductal carcinoma in situ -1.100 0.003
ovarian cancer -1.700 0.000

Synonym

Accession Q14995 B2R8Q3 O00402 Q86XD4
Symbols RVR
BD73
EAR-1R

Gene

PDB

2V0V   2V7C   3CQV   4N73  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid

  TechDev Info (2)

Steve Finkbeiner Neuron specific phenotypes being screened
Jun Qin Signaling network evaluation of transcript factor crosstalk via catTRE/MS

 GO Component (2)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
2277 screening 14 / 0 / 0 Center Based Initiative to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors.
504934 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors

Gene RIF (10)

PMID Text
26670607 heme is involved in regulating the degradation of Rev-erbbeta in a manner consistent with its role in circadian rhythm maintenance
26616049 Together, the findings demonstrate an anti-inflammatory effect, downregulating of MMP-9 and CCL2 transcription, of astroglial REV-ERBs activation through HDAC3-dependent and HDAC3-independent mechanisms.
25023698 REV-ERBbeta plays a role in supporting cancer cell viability when autophagy is compromised.
24872411 Cobalt protoporphyrin IX (CoPP) and zinc protoporphyrin IX (ZnPP) are ligands that bind directly to the REV-ERBs. However, instead of mimicking the agonist action of heme, CoPP and ZnPP function as antagonists of REV-ERB function.
24173768 REV-ERB-ALPHA circadian gene variant associates with obesity in two independent populations: Mediterranean and North American.
22828941 Our results suggest that the REV-ERBalpha rs2071427 polymorphism modulates body fat mass in both adult and young people.
21123168 oxidative stress leads to oxidation of cysteine(s), thus releasing heme from Rev-erbbeta and altering its transcriptional activity.
20348464 Nuclear receptor rev-erb-{alpha} circadian gene variants have a role in response to lithium carbonate in bipolar affective disorder
18037887 heme regulation of REV-ERBs may link the control of metabolism and the mammalian clock
17996965 Rev-erbbeta modulates the apoCIII gene expression by recruiting different transcription co-activator or co-repressor.

AA Sequence

MEVNAGGVIAYISSSSSASSPASCHSEGSENSFQSSSSSVPSSPNSSNSDTNGNPKNGDLANIEGILKND      1 - 70
RIDCSMKTSKSSAPGMTKSHSGVTKFSGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQYKKC     71 - 140
LKNENCSIMRMNRNRCQQCRFKKCLSVGMSRDAVRFGRIPKREKQRMLIEMQSAMKTMMNSQFSGHLQND    141 - 210
TLVEHHEQTALPAQEQLRPKPQLEQENIKSSSPPSSDFAKEEVIGMVTRAHKDTFMYNQEQQENSAESMQ    211 - 280
PQRGERIPKNMEQYNLNHDHCGNGLSSHFPCSESQQHLNGQFKGRNIMHYPNGHAICIANGHCMNFSNAY    281 - 350
TQRVCDRVPIDGFSQNENKNSYLCNTGGRMHLVCPLSKSPYVDPHKSGHEIWEEFSMSFTPAVKEVVEFA    351 - 420
KRIPGFRDLSQHDQVNLLKAGTFEVLMVRFASLFDAKERTVTFLSGKKYSVDDLHSMGAGDLLNSMFEFS    421 - 490
EKLNALQLSDEEMSLFTAVVLVSADRSGIENVNSVEALQETLIRALRTLIMKNHPNEASIFTKLLLKLPD    491 - 560
LRSLNNMHSEELLAFKVHP                                                       561 - 579
//

Text Mined References (30)

PMID Year Title
26670607 2016 High Affinity Heme Binding to a Heme Regulatory Motif on the Nuclear Receptor Rev-erb? Leads to Its Degradation and Indirectly Regulates Its Interaction with Nuclear Receptor Corepressor.
26616049 2016 Stimulation of nuclear receptor REV-ERBs regulates tumor necrosis factor-induced expression of proinflammatory molecules in C6 astroglial cells.
25023698 2015 Dual inhibition of REV-ERB? and autophagy as a novel pharmacological approach to induce cytotoxicity in cancer cells.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24872411 2014 Structure of REV-ERB? ligand-binding domain bound to a porphyrin antagonist.
24173768 2014 REV-ERB-ALPHA circadian gene variant associates with obesity in two independent populations: Mediterranean and North American.
23555304 2013 Dynamic circadian protein-protein interaction networks predict temporal organization of cellular functions.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
22828941 2013 Impact of REV-ERB alpha gene polymorphisms on obesity phenotypes in adult and adolescent samples.
22682217 2012 REV-ERBs: more than the sum of the individual parts.
More...