Property Summary

NCBI Gene PubMed Count 94
Grant Count 118
R01 Count 74
Funding $9,906,317.81
PubMed Score 258.05
PubTator Score 341.70

Knowledge Summary

Patent (13,855)

Expression

Gene

PDB

1XV9   1XVP  

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
2277 screening 14 / 0 / 0 Center Based Initiative to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors.
504934 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors

Gene RIF (77)

PMID Text
26275810 These results reveal both novel and known targets of hCAR and support the role of hCAR in maintaining the homeostasis of metabolism and cell proliferation in the liver.
26188155 The homozygous variant genotype of MPJ6_1I3008 is associated with a significant reduced risk of neonatal hyperbilirubinemia in females.
25835148 Suggest that PXR and CAR double humanized mice are more sensitive rifampcin induction of cytochrome P450 and UDP-glucuronosyltransferases.
25721668 PRMT5 enhances transcriptional activity of constitutive androstane receptor.PRMT5 is a gene-selective co-activator for CAR.
25356900 Around 42.5% of the overall interindividual variability in warfarin dose requirements was explained : VKORC1 genotype accounted for 29.6%, CYP2C9 genotype for 4.3%, age for 3.6%, the CYP4F2 genotype for 3.3%, and CAR/HNF4alpha (rs2501873/rs3212198) for 1.7%
25155144 The nuclear receptor constitutive androstane receptor/NR1I3 enhances the profibrotic effects of transforming growth factor beta and contributes to the development of experimental dermal fibrosis.
24859622 It is suggested that the functions of PXR, CAR and AhR may be closely implicated in the pathogeneses of metabolic vascular diseases, such as hyperlipidemia, atherogenesis, and hypertension.
24789201 ubiquitin-proteasomal regulation of CCRP and HSP70 are important contributors to the regulation of cytoplasmic CAR levels, and hence the ability of CAR to respond to PB or PB-like inducers
24351870 Donor CYP3A5, NR1I3 gene polymorphisms.
24232815 The polymorphisms investigated in PPARA (rs1800206), RXRA (rs11381416), and NR1I2 (rs1523130) did not influence the lipid-lowering efficacy and safety of statin and our results show the possible influence of NR1I3 genetic variant on the safety of statin.
More...

AA Sequence

MASREDELRNCVVCGDQATGYHFNALTCEGCKGFFRRTVSKSIGPTCPFAGSCEVSKTQRRHCPACRLQK      1 - 70
CLDAGMRKDMILSAEALALRRAKQAQRRAQQTPVQLSKEQEELIRTLLGAHTRHMGTMFEQFVQFRPPAH     71 - 140
LFIHHQPLPTLAPVLPLVTHFADINTFMVLQVIKFTKDLPVFRSLPIEDQISLLKGAAVEICHIVLNTTF    141 - 210
CLQTQNFLCGPLRYTIEDGARVSPTVGFQVEFLELLFHFHGTLRKLQLQEPEYVLLAAMALFSPDRPGVT    211 - 280
QRDEIDQLQEEMALTLQSYIKGQQRRPRDRFLYAKLLGLLAELRSINEAYGYQIQHIQGLSAMMPLLQEI    281 - 350
CS                                                                        351 - 352
//

Text Mined References (96)

PMID Year Title
26275810 2015 Genome-wide analysis of human constitutive androstane receptor (CAR) transcriptome in wild-type and CAR-knockout HepaRG cells.
26188155 2015 High resolution melting analysis of the NR1I3 genetic variants: Is there an association with neonatal hyperbilirubinemia?
25835148 2015 Expression of hepatic cytochrome P450s and UDP-glucuronosyltransferases in PXR and CAR double humanized mice treated with rifampicin.
25721668 2015 Protein arginine methyltransferase 5 (PRMT5) is a novel coactivator of constitutive androstane receptor (CAR).
25356900 2015 Combined effects of hepatocyte nuclear factor 4? and constitutive androstane receptor on stable warfarin doses.
25155144 2014 The nuclear receptor constitutive androstane receptor/NR1I3 enhances the profibrotic effects of transforming growth factor ? and contributes to the development of experimental dermal fibrosis.
24859622 2014 Roles of xenobiotic receptors in vascular pathophysiology.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24789201 2014 Coordinated regulation of nuclear receptor CAR by CCRP/DNAJC7, HSP70 and the ubiquitin-proteasome system.
24351870 2014 Association of hemoglobin levels, CYP3A5, and NR1I3 gene polymorphisms with tacrolimus pharmacokinetics in liver transplant patients.
More...