Property Summary

Ligand Count 18
NCBI Gene PubMed Count 99
PubMed Score 281.22
PubTator Score 341.70

Knowledge Summary

Patent (13,855)

Expression

 GWAS Trait (1)

Protein-protein Interaction (11)

Gene RIF (82)

AA Sequence

MASREDELRNCVVCGDQATGYHFNALTCEGCKGFFRRTVSKSIGPTCPFAGSCEVSKTQRRHCPACRLQK      1 - 70
CLDAGMRKDMILSAEALALRRAKQAQRRAQQTPVQLSKEQEELIRTLLGAHTRHMGTMFEQFVQFRPPAH     71 - 140
LFIHHQPLPTLAPVLPLVTHFADINTFMVLQVIKFTKDLPVFRSLPIEDQISLLKGAAVEICHIVLNTTF    141 - 210
CLQTQNFLCGPLRYTIEDGARVSPTVGFQVEFLELLFHFHGTLRKLQLQEPEYVLLAAMALFSPDRPGVT    211 - 280
QRDEIDQLQEEMALTLQSYIKGQQRRPRDRFLYAKLLGLLAELRSINEAYGYQIQHIQGLSAMMPLLQEI    281 - 350
CS                                                                        351 - 352
//

Text Mined References (101)

PMID Year Title