Property Summary

NCBI Gene PubMed Count 21
PubMed Score 47.66
PubTator Score 69.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

Synonym

Accession Q14990 Q3SX72
Symbols ODF
RT7
ODF2
ODFP
SODF
CT133
ODF27
ODFPG
HSPB10
ODFPGA
ODFPGB

Gene

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20112736 The expression of ODF1 was significantly decreased in the ejaculated spermatozoa of asthenozoospermic men.

AA Sequence

MAALSCLLDSVRRDIKKVDRELRQLRCIDEFSTRCLCDLYMHPYCCCDLHPYPYCLCYSKRSRSCGLCDL      1 - 70
YPCCLCDYKLYCLRPSLRSLERKAIRAIEDEKRELAKLRRTTNRILASSCCSSNILGSVNVCGFEPDQVK     71 - 140
VRVKDGKVCVSAERENRYDCLGSKKYSYMNICKEFSLPPCVDEKDVTYSYGLGSCVKIESPCYPCTSPCS    141 - 210
PCSPCSPCNPCSPCNPCSPYDPCNPCYPCGSRFSCRKMIL                                  211 - 250
//

Text Mined References (21)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23770605 2013 Genome-wide association study identifies multiple risk loci for chronic lymphocytic leukemia.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21597245 2011 Human t-complex protein 11 (TCP11), a testis-specific gene product, is a potential determinant of the sperm morphology.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20112736 2009 [Differential expression of ODF1 in human ejaculated spermatozoa and its clinical significance].
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12594206 2003 Association of kinesin light chain with outer dense fibers in a microtubule-independent fashion.
12533418 2003 Novel RING finger protein OIP1 binds to conserved amino acid repeats in sperm tail protein ODF1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...