Property Summary

NCBI Gene PubMed Count 22
PubMed Score 50.22
PubTator Score 69.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Infertility 188 3.469 1.7
Male infertility 206 3.415 1.7

Expression

Synonym

Accession Q14990 Q3SX72
Symbols ODF
RT7
ODF2
ODFP
SODF
CT133
ODF27
ODFPG
HSPB10
ODFPGA
ODFPGB

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MAALSCLLDSVRRDIKKVDRELRQLRCIDEFSTRCLCDLYMHPYCCCDLHPYPYCLCYSKRSRSCGLCDL      1 - 70
YPCCLCDYKLYCLRPSLRSLERKAIRAIEDEKRELAKLRRTTNRILASSCCSSNILGSVNVCGFEPDQVK     71 - 140
VRVKDGKVCVSAERENRYDCLGSKKYSYMNICKEFSLPPCVDEKDVTYSYGLGSCVKIESPCYPCTSPCS    141 - 210
PCSPCSPCNPCSPCNPCSPYDPCNPCYPCGSRFSCRKMIL                                  211 - 250
//

Text Mined References (22)

PMID Year Title