Property Summary

NCBI Gene PubMed Count 45
PubMed Score 48.13
PubTator Score 159.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
acute quadriplegic myopathy 1.094 2.7e-08
atypical teratoid / rhabdoid tumor 1.100 2.8e-06
colon cancer 1.600 1.9e-04
cutaneous lupus erythematosus 1.200 1.3e-03
dermatomyositis 1.100 6.5e-04
invasive ductal carcinoma -1.190 2.9e-03
lung cancer 1.300 6.5e-03
malignant mesothelioma 1.300 5.4e-07
medulloblastoma, large-cell 1.900 1.7e-04
Multiple myeloma 1.187 3.7e-04
osteosarcoma 1.528 1.3e-04
psoriasis 1.200 1.5e-09
subependymal giant cell astrocytoma -1.073 1.6e-02
Waldenstrons macroglobulinemia 1.333 9.2e-04

Gene RIF (20)

AA Sequence

MADAGIRRVVPSDLYPLVLGFLRDNQLSEVANKFAKATGATQQDANASSLLDIYSFWLKSAKVPERKLQA      1 - 70
NGPVAKKAKKKASSSDSEDSSEEEEEVQGPPAKKAAVPAKRVGLPPGKAAAKASESSSSEESSDDDDEED     71 - 140
QKKQPVQKGVKPQAKAAKAPPKKAKSSDSDSDSSSEDEPPKNQKPKITPVTVKAQTKAPPKPARAAPKIA    141 - 210
NGKAASSSSSSSSSSSSDDSEEEKAAATPKKTVPKKQVVAKAPVKAATTPTRKSSSSEDSSSDEEEEQKK    211 - 280
PMKNKPGPYSSVPPPSAPPPKKSLGTQPPKKAVEKQQPVESSEDSSDESDSSSEEEKKPPTKAVVSKATT    281 - 350
KPPPAKKAAESSSDSSDSDSSEDDEAPSKPAGTTKNSSNKPAVTTKSPAVKPAAAPKQPVGGGQKLLTRK    351 - 420
ADSSSSEEESSSSEEEKTKKMVATTKPKATAKAALSLPAKQAPQGSRDSSSDSDSSSSEEEEEKTSKSAV    421 - 490
KKKPQKVAGGAAPSKPASAKKGKAESSNSSSSDDSSEEEEEKLKGKGSPRPQAPKANGTSALTAQNGKAA    491 - 560
KNSEEEEEEKKKAAVVVSKSGSLKKRKQNEAAKEAETPQAKKIKLQTPNTFPKRKKGEKRASSPFRRVRE    561 - 630
EEIEVDSRVADNSFDAKRGAAGDWGERANQVLKFTKGKSFRHEKTKKKRGSYRGGSISVQVNSIKFDSE     631 - 699
//

Text Mined References (65)

PMID Year Title