Property Summary

NCBI Gene PubMed Count 43
Grant Count 6
R01 Count 5
Funding $733,243
PubMed Score 44.46
PubTator Score 159.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Synonym

Accession Q14978 Q15030 Q5VV70 Q9BUV3
Symbols P130
NOPP130
NOPP140
NS5ATP13

Gene

Gene RIF (19)

PMID Text
25645906 D120 and R195 of H5N1 influenza virus NS1 were crucial for the binding to host NOLC1.
25205458 pRb2/p130 cytoplasmic delocalization can lead to cell cycle deregulation
24218616 A Nopp140 fragment (residues 568-596) and inositol hexakisphosphate competitively bind to the catalytic subunit of CK2 (CK2alpha), and phospho-Ser574 of Nopp140 significantly enhances its interaction with CK2alpha.
23970161 our study demonstrated that DNA methylation is a key mechanism of silenced NOLC1 expression in human hepatocellular carcinoma cells, and NOLC1 gene hypermethylation of the four CpG dinucleotides is a potential biomarker for hepatocellular carcinoma.
23188192 H5N1 viral NS1 interacts with host NOLC1 protein.
22906532 Structural disorder and local order of hNopp140
22190034 HIV-1 MA is identified to have a physical interaction with nucleolar and coiled-body phosphoprotein 1 (NOLC1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21266110 The regulation of NOCL1 protein is a critical role for the transcription NF-kB and cAMP response element-bing protein
19541936 both NOLC1 and tumor protein 53 work together synergistically to activate the MDM2 promoter in NPC cells.
19381672 Nopp140 could be a component implicated in the early steps of pre-rRNA processing.
More...

AA Sequence

MADAGIRRVVPSDLYPLVLGFLRDNQLSEVANKFAKATGATQQDANASSLLDIYSFWLKSAKVPERKLQA      1 - 70
NGPVAKKAKKKASSSDSEDSSEEEEEVQGPPAKKAAVPAKRVGLPPGKAAAKASESSSSEESSDDDDEED     71 - 140
QKKQPVQKGVKPQAKAAKAPPKKAKSSDSDSDSSSEDEPPKNQKPKITPVTVKAQTKAPPKPARAAPKIA    141 - 210
NGKAASSSSSSSSSSSSDDSEEEKAAATPKKTVPKKQVVAKAPVKAATTPTRKSSSSEDSSSDEEEEQKK    211 - 280
PMKNKPGPYSSVPPPSAPPPKKSLGTQPPKKAVEKQQPVESSEDSSDESDSSSEEEKKPPTKAVVSKATT    281 - 350
KPPPAKKAAESSSDSSDSDSSEDDEAPSKPAGTTKNSSNKPAVTTKSPAVKPAAAPKQPVGGGQKLLTRK    351 - 420
ADSSSSEEESSSSEEEKTKKMVATTKPKATAKAALSLPAKQAPQGSRDSSSDSDSSSSEEEEEKTSKSAV    421 - 490
KKKPQKVAGGAAPSKPASAKKGKAESSNSSSSDDSSEEEEEKLKGKGSPRPQAPKANGTSALTAQNGKAA    491 - 560
KNSEEEEEEKKKAAVVVSKSGSLKKRKQNEAAKEAETPQAKKIKLQTPNTFPKRKKGEKRASSPFRRVRE    561 - 630
EEIEVDSRVADNSFDAKRGAAGDWGERANQVLKFTKGKSFRHEKTKKKRGSYRGGSISVQVNSIKFDSE     631 - 699
//

Text Mined References (62)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25645906 2015 Identification of NS1 domains of avian H5N1 influenza virus which influence the interaction with the NOLC1 protein.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25205458 2015 pRb2/p130 localizes to the cytoplasm in diffuse gastric cancer.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24218616 2013 Structural and functional insights into the regulation mechanism of CK2 by IP6 and the intrinsically disordered protein Nopp140.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
More...