Property Summary

NCBI Gene PubMed Count 169
Grant Count 9
R01 Count 4
Funding $1,014,459.79
PubMed Score 31.53
PubTator Score 46.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.077 0.004
psoriasis -3.800 0.000
osteosarcoma -1.529 0.000
group 3 medulloblastoma 1.300 0.001
astrocytoma 2.000 0.002
glioblastoma 1.400 0.024
medulloblastoma, large-cell 1.300 0.000
pancreatic ductal adenocarcinoma liver m... 1.334 0.033
lung cancer 1.400 0.002
pediatric high grade glioma 1.100 0.000
atypical teratoid/rhabdoid tumor 1.300 0.000
subependymal giant cell astrocytoma 1.148 0.025
lung adenocarcinoma 1.198 0.000
Pick disease 1.100 0.000
ovarian cancer 3.000 0.000
dermatomyositis 1.200 0.001

 GWAS Trait (1)

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
540253 confirmatory 242 / 15675 / 325034 qHTS Assay for Inhibitors of RanGTP induced Rango (Ran-regulated importin-beta cargo) - Importin beta complex dissociation
540262 summary 0 / 0 / 0 Inhibitors of RanGTP induced Rango (Ran-regulated importin-beta cargo) - Importin beta complex dissociation: Summary
540263 confirmatory 105 / 27765 / 313081 qHTS Assay for Inhibitors of Rango (Ran-regulated importin-beta cargo) - Importin beta complex formation
540273 summary 0 / 0 / 0 Inhibitors of Rango (Ran-regulated importin-beta cargo) - Importin beta complex formation: Summary

Gene RIF (112)

PMID Text
26498772 Patients with tumors highly expressing Kpnbeta1 have poorer overall survivals. Kpnbeta1 interacts with p65 and enhances cell adhesion-mediated drug resistance.
26491019 RBBP4 functions as a novel regulatory factor to increase the efficiency of importin alpha/beta-mediated nuclear import
26414402 Data show that cytoskeleton associated protein 5 (chTOG) only weakly promotes importin-regulated microtubule nucleation, but acts synergistically with microtubule- associated protein TPX2.
26319354 Collectively, these data show that KPNB1 is required for timely nuclear import of PER/CRY in the negative feedback regulation of the circadian clock.
26216267 Humanin Peptide Binds to Insulin-Like Growth Factor-Binding Protein 3 (IGFBP3) and Regulates Its Interaction with Importin-beta.
26112410 The study revealed a regulatory role of the p97-Npl4-Ufd1 complex in regulating a partial degradation of the NF-kappaB subunit p100.
26107903 Importin-beta1 mediates the non-classical nucleocytoplasmic transport of MARVELD1.
25960398 This hypersensitivity of malignant cell types to Impbeta1 knockdown raises the exciting possibility of anti-cancer therapies targeted at Impbeta1.
25890085 DZNep suppressed EZH2/miR-30a,d/KPNB1 signaling.
25794490 High expression of KPNB1 protein is associated with hepatocellular carcinoma.
More...

AA Sequence

MELITILEKTVSPDRLELEAAQKFLERAAVENLPTFLVELSRVLANPGNSQVARVAAGLQIKNSLTSKDP      1 - 70
DIKAQYQQRWLAIDANARREVKNYVLQTLGTETYRPSSASQCVAGIACAEIPVNQWPELIPQLVANVTNP     71 - 140
NSTEHMKESTLEAIGYICQDIDPEQLQDKSNEILTAIIQGMRKEEPSNNVKLAATNALLNSLEFTKANFD    141 - 210
KESERHFIMQVVCEATQCPDTRVRVAALQNLVKIMSLYYQYMETYMGPALFAITIEAMKSDIDEVALQGI    211 - 280
EFWSNVCDEEMDLAIEASEAAEQGRPPEHTSKFYAKGALQYLVPILTQTLTKQDENDDDDDWNPCKAAGV    281 - 350
CLMLLATCCEDDIVPHVLPFIKEHIKNPDWRYRDAAVMAFGCILEGPEPSQLKPLVIQAMPTLIELMKDP    351 - 420
SVVVRDTAAWTVGRICELLPEAAINDVYLAPLLQCLIEGLSAEPRVASNVCWAFSSLAEAAYEAADVADD    421 - 490
QEEPATYCLSSSFELIVQKLLETTDRPDGHQNNLRSSAYESLMEIVKNSAKDCYPAVQKTTLVIMERLQQ    491 - 560
VLQMESHIQSTSDRIQFNDLQSLLCATLQNVLRKVQHQDALQISDVVMASLLRMFQSTAGSGGVQEDALM    561 - 630
AVSTLVEVLGGEFLKYMEAFKPFLGIGLKNYAEYQVCLAAVGLVGDLCRALQSNIIPFCDEVMQLLLENL    631 - 700
GNENVHRSVKPQILSVFGDIALAIGGEFKKYLEVVLNTLQQASQAQVDKSDYDMVDYLNELRESCLEAYT    701 - 770
GIVQGLKGDQENVHPDVMLVQPRVEFILSFIDHIAGDEDHTDGVVACAAGLIGDLCTAFGKDVLKLVEAR    771 - 840
PMIHELLTEGRRSKTNKAKTLATWATKELRKLKNQA                                      841 - 876
//

Text Mined References (189)

PMID Year Title
26498772 2016 Upregulation of nuclear transporter, Kpn?1, contributes to accelerated cell proliferation- and cell adhesion-mediated drug resistance (CAM-DR) in diffuse large B-cell lymphoma.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26491019 2015 Retinoblastoma-binding Protein 4-regulated Classical Nuclear Transport Is Involved in Cellular Senescence.
26414402 2015 Complementary activities of TPX2 and chTOG constitute an efficient importin-regulated microtubule nucleation module.
26319354 2015 KPNB1 mediates PER/CRY nuclear translocation and circadian clock function.
26216267 2015 Humanin Peptide Binds to Insulin-Like Growth Factor-Binding Protein 3 (IGFBP3) and Regulates Its Interaction with Importin-?.
26112410 2015 The Transitional Endoplasmic Reticulum ATPase p97 Regulates the Alternative Nuclear Factor NF-?B Signaling via Partial Degradation of the NF-?B Subunit p100.
26107903 [Importin-?1 plays a key role in the nucleocytoplasmic transportation process of MARVELD1].
25960398 2015 Hyper-dependence of breast cancer cell types on the nuclear transporter Importin ?1.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
More...