Property Summary

NCBI Gene PubMed Count 44
Grant Count 68
R01 Count 51
Funding $12,961,380.44
PubMed Score 411.83
PubTator Score 257.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.040 0.000
colon cancer -1.400 0.000
lung cancer -2.900 0.000

Synonym

Accession Q14973 B9EGB6 Q2TU29
Symbols NTCP

Gene

PANTHER Protein Class (2)

Gene RIF (39)

PMID Text
26865711 We describe for the first time a mouse liver cell line that, solely upon expression of the hNTCP receptor, becomes susceptible to HBV.
26592202 Hepatitis B virus efficiently infects non-adherent hepatoma cells via NTCP, which functions as a virus receptor.
26019035 Liver nuclear receptors, FXR and SHP, and bile acid transporters, NTCP and BSEP, are associated with the progression of NAFLD.
25985569 NTCP polymorphism play a critical role in the individual variability of rosuvastatin pharmacokinetics in Chinese healthy males
25929767 The observation that the pharmacological inhibitors of the NTCP transporter could block HBV entry suggests that NTCP represents an attractive molecular target for therapeutic intervention in HBV infection.
25765005 Interleukin 6 inhibits HBV entry through downregulation of NTCP.
25550158 Data indicate that retinoic acid receptor (RAR) is crucial for regulating sodium taurocholate cotransporting polypeptide (NTCP) expression that determines permissiveness to hepatitis B virus (HBV) infection.
25409679 NTCP is a functional receptor for hepatitis B virus and hepatitis D virus.
25168282 hNTCP is an electrogenic Na(+)-dependent transporter
25010264 This study suggests that polymorphisms in the NTCP region may be associated with the natural course of HBV infection.
More...

AA Sequence

MEAHNASAPFNFTLPPNFGKRPTDLALSVILVFMLFFIMLSLGCTMEFSKIKAHLWKPKGLAIALVAQYG      1 - 70
IMPLTAFVLGKVFRLKNIEALAILVCGCSPGGNLSNVFSLAMKGDMNLSIVMTTCSTFCALGMMPLLLYI     71 - 140
YSRGIYDGDLKDKVPYKGIVISLVLVLIPCTIGIVLKSKRPQYMRYVIKGGMIIILLCSVAVTVLSAINV    141 - 210
GKSIMFAMTPLLIATSSLMPFIGFLLGYVLSALFCLNGRCRRTVSMETGCQNVQLCSTILNVAFPPEVIG    211 - 280
PLFFFPLLYMIFQLGEGLLLIAIFWCYEKFKTPKDKTKMIYTAATTEETIPGALGNGTYKGEDCSPCTA     281 - 349
//

Publication (44)

PMID Year Title
26865711 2016 Hepatitis B Virus Infection of a Mouse Hepatic Cell Line Reconstituted with Human Sodium Taurocholate Cotransporting Polypeptide.
26592202 2015 Hepatitis B virus efficiently infects non-adherent hepatoma cells via human sodium taurocholate cotransporting polypeptide.
26019035 The nuclear receptor FXR, but not LXR, up-regulates bile acid transporter expression in non-alcoholic fatty liver disease.
25985569 2014 The effect of Na+/taurocholate cotransporting polypeptide (NTCP) c.800C > T polymorphism on rosuvastatin pharmacokinetics in Chinese healthy males.
25929767 2015 The FDA-approved drug irbesartan inhibits HBV-infection in HepG2 cells stably expressing sodium taurocholate co-transporting polypeptide.
25765005 2015 Interleukin 6 inhibits HBV entry through NTCP down regulation.
25550158 2015 Dysregulation of retinoic acid receptor diminishes hepatocyte permissiveness to hepatitis B virus infection through modulation of sodium taurocholate cotransporting polypeptide (NTCP) expression.
25409679 2012 Sodium taurocholate cotransporting polypeptide is a functional receptor for human hepatitis B and D virus.
25168282 2014 Electrophysiological characterization of human Na?/taurocholate cotransporting polypeptide (hNTCP) heterologously expressed in Xenopus laevis oocytes.
25010264 2014 Association of the gene polymorphisms in sodium taurocholate cotransporting polypeptide with the outcomes of hepatitis B infection in Chinese Han population.
More...