Property Summary

Ligand Count 10
NCBI Gene PubMed Count 52
PubMed Score 476.10
PubTator Score 257.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
colon cancer -1.400 3.6e-04
lung cancer -2.900 3.6e-05
osteosarcoma 1.040 2.9e-05

Gene RIF (47)

AA Sequence

MEAHNASAPFNFTLPPNFGKRPTDLALSVILVFMLFFIMLSLGCTMEFSKIKAHLWKPKGLAIALVAQYG      1 - 70
IMPLTAFVLGKVFRLKNIEALAILVCGCSPGGNLSNVFSLAMKGDMNLSIVMTTCSTFCALGMMPLLLYI     71 - 140
YSRGIYDGDLKDKVPYKGIVISLVLVLIPCTIGIVLKSKRPQYMRYVIKGGMIIILLCSVAVTVLSAINV    141 - 210
GKSIMFAMTPLLIATSSLMPFIGFLLGYVLSALFCLNGRCRRTVSMETGCQNVQLCSTILNVAFPPEVIG    211 - 280
PLFFFPLLYMIFQLGEGLLLIAIFWCYEKFKTPKDKTKMIYTAATTEETIPGALGNGTYKGEDCSPCTA     281 - 349
//

Text Mined References (52)

PMID Year Title