Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.49
PubTator Score 3.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
medulloblastoma, large-cell 6241 4.5e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Chlamydia 21 3.389 1.7

Expression

  Differential Expression (1)

Disease log2 FC p
medulloblastoma, large-cell 1.300 4.5e-05

Gene RIF (3)

AA Sequence

METIWIYQFRLIVIGDSTVGKSCLLHRFTQGRFPGLRSPACDPTVGVDFFSRLLEIEPGKRIKLQLWDTA      1 - 70
GQERFRSITRSYYRNSVGGFLVFDITNRRSFEHVKDWLEEAKMYVQPFRIVFLLVGHKCDLASQRQVTRE     71 - 140
EAEKLSADCGMKYIETSAKDATNVEESFTILTRDIYELIKKGEICIQDGWEGVKSGFVPNTVHSSEEAVK    141 - 210
PRKECFC                                                                   211 - 217
//

Text Mined References (10)

PMID Year Title