Property Summary

NCBI Gene PubMed Count 9
Grant Count 2
Funding $47,770.38
PubMed Score 3.49
PubTator Score 3.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (1)

Disease log2 FC p
medulloblastoma, large-cell 1.300 0.000

Synonym

Accession Q14964 A8KAA4 Q8N6W2 Rab-39
Symbols RAB39

Gene

 Grant Application (2)

 GO Function (1)

Gene RIF (3)

PMID Text
26163492 our findings indicate that Rab39a favours chlamydial replication and infectivity. This is the first report showing that a late endocytic Rab GTPase is involved in chlamydial infection development.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19833722 Results show that Rab39a interacts with caspase-1 and suggest that Rab39a functions as a trafficking adaptor linking caspase-1 to IL-1beta secretion.

AA Sequence

METIWIYQFRLIVIGDSTVGKSCLLHRFTQGRFPGLRSPACDPTVGVDFFSRLLEIEPGKRIKLQLWDTA      1 - 70
GQERFRSITRSYYRNSVGGFLVFDITNRRSFEHVKDWLEEAKMYVQPFRIVFLLVGHKCDLASQRQVTRE     71 - 140
EAEKLSADCGMKYIETSAKDATNVEESFTILTRDIYELIKKGEICIQDGWEGVKSGFVPNTVHSSEEAVK    141 - 210
PRKECFC                                                                   211 - 217
//

Text Mined References (10)

PMID Year Title
26163492 2015 The late endocytic Rab39a GTPase regulates the interaction between multivesicular bodies and chlamydial inclusions.
25416956 2014 A proteome-scale map of the human interactome network.
24349490 2013 Rab39a interacts with phosphatidylinositol 3-kinase and negatively regulates autophagy induced by lipopolysaccharide stimulation in macrophages.
21255211 2011 Rab GTPases regulating phagosome maturation are differentially recruited to mycobacterial phagosomes.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19833722 2009 Rab39a binds caspase-1 and is required for caspase-1-dependent interleukin-1beta secretion.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9119394 1997 Construction of a transcription map around the gene for ataxia telangiectasia: identification of at least four novel genes.