Property Summary

NCBI Gene PubMed Count 127
PubMed Score 0.00
PubTator Score 228.53

Knowledge Summary

Patent

No data available

Gene RIF (118)

PMID Text
26744892 The activating KIR gene KIR2DS1 has an important predictive potential for early onset of type 1 autoimmune hepatitis.
26744525 functional interactions between KIR and HLA modify risks of BCC and SCC and that KIR encoded by the B genes provides selective pressure for altered p53 in BCC tumors.
26589762 Recurrent Pregnancy Loss in Women with Killer Cell Immunoglobulin-Like Receptor KIR2DS1 is Associated with an Increased HLA-C2 Allelic Frequency
26542066 KIR2DS1-C2C2 is less frequent in type 1 diabetes in Saudi children
25960307 Absence of HLA-C2 for donor KIR2DL1 was associated with higher grade II to IV (HR, 1.4; P = .002) and III to IV acute GVHD (HR, 1.5; P = .01) compared with HLA-C2(+) patients.
25581336 the frequencies of HLA-Cw07 were statistically significantly higher in the patient group than those in the control group (P = 0.009). KIR2DS1(+) HLA(-) Cw(Lys) was more common in subjects with SLE
25491925 Moreover, the frequency of activating genotypes in the AS patient group was significantly higher than in the healthy control group (P < 0.05). KIR2DS1 and KIR3DS1
25253288 Data show that KIR2DL5 receptor, KIR2DS1 protein, KIR2DS5 protein and KIR3DS1 receptors were all significantly associated with high viral load.
24911933 frequency of the maternal KIR2DS1 gene lower in the preeclampsia group than control group
24839813 Different expression levels of KIR2DL1 may contribute to the abnormal function of natural killer (NK) and NKT lymphocytes, which lead to the risk of systemic lupus erythematosus (SLE) susceptibility.
More...

AA Sequence

MSLTVVSMACVGFFLLQGAWPHEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGMFNDTL      1 - 70
RLIGEHHDGVSKANFSISRMRQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVIIGLYEKPSLSAQPGPTVL     71 - 140
AGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGTKVNGTFQANFPLGPATHGGTYRCFGSFRDSPYEWS    141 - 210
KSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLHVLIGTSVVKIPFTILLFFLLHRWCSDKKNAAVMDQ    211 - 280
EPAGNRTVNSEDSDEQDHQEVSYA                                                  281 - 304
//

Publication (127)

PMID Year Title
26744892 2016 Exploring the Role of Killer Cell Immunoglobulin-Like Receptors and Their HLA Class I Ligands in Autoimmune Hepatitis.
26744525 2016 Skin Cancer Risk Is Modified by KIR/HLA Interactions That Influence the Activation of Natural Killer Immune Cells.
26589762 2016 Recurrent Pregnancy Loss in Women with Killer Cell Immunoglobulin-Like Receptor KIR2DS1 is Associated with an Increased HLA-C2 Allelic Frequency.
26542066 2016 Investigation of activating and inhibitory killer cell immunoglobulin-like receptors and their putative ligands in type 1 diabetes (T1D).
25960307 2015 Impact of KIR and HLA Genotypes on Outcomes after Reduced-Intensity Conditioning Hematopoietic Cell Transplantation.
25581336 2015 Association of killer cell immunoglobulin-like receptor and human leucocyte antigen-Cw gene combinations with systemic lupus erythematosus.
25491925 2015 Activating killer immunoglobulin-like receptors genes are associated with increased susceptibility to ankylosing spondylitis.
25253288 2014 Killer immunoglobulin-like receptor gene repertoire influences viral load of primary human cytomegalovirus infection in renal transplant patients.
24911933 2014 Interaction of parental KIR and fetal HLA-C genotypes with the risk of preeclampsia.
24839813 2014 The aberrant expression of stimulatory and inhibitory killer immunoglobulin-like receptors in NK- and NKT-cells contributes to lupus.
More...