Property Summary

NCBI Gene PubMed Count 100
PubMed Score 0.00
PubTator Score 35.24

Knowledge Summary

Patent

No data available

Gene RIF (98)

PMID Text
26255774 study compared KIR gene repertoire of HIV-1 positive with exposed uninfected (EU)) infants to elucidate its association with transmission; results revealed presence of significantly high frequencies of activating gene KIR 2DS5 and inhibitory gene KIR 2DL3 in EU infants as compared to HIV-1 positive infants
25724317 The presence ofKIR2DS5 reduced the risk of endometriosis if a female possessed alleles from group C2 of HLA-C.
25253288 Data show that KIR2DL5 receptor, KIR2DS1 protein, KIR2DS5 protein and KIR3DS1 receptors were all significantly associated with high viral load.
24929143 The genes KIR2DL5, KIR2DS3 and KIR2DS5 were present in a significantly higher proportion of individuals in the asymptomatic control group than in the malaria cases.
24571473 The presence of KIR2DS2/2DL2 with KIR2DS5 abrogated the risk of KIR2DS2/2DL2 and the protective benefit of KIR2DS5.
24269691 genetic polymorphism impacts glycosylation and protein expression level
23028591 Results suggest a protective role of KIR2DS5 in graft rejection and an association of KIR2DS4 with kidney rejection, particularly in recipients with glomerulonephritis.
22836040 The activating KIR2DS5 gene was significantly increased in thyroid ancer patients compared to the controls.
22652695 Data indicate that killer-cell immunoglobulin-like receptors (KIRs)activator (KIR3DS1 and KIR2DS5) and inhibitory (KIR2DL5) genes are associated with severe pandemic influenza A (H1N1) 2009 infections.
22376216 In summary, KIR polymorphisms may be involved in the development of Epstein-Barr virus associated hemophagocytic lymphohistiocytosis, with KIR2DS5 promoting susceptibility to this disease.
More...

AA Sequence

MLLMVISMACVAFFLLQGAWPHEGFRRKPSLLAHPGPLVKSEETVILQCWSDVMFEHFLLHREGTFNHTL      1 - 70
RLIGEHIDGVSKGNFSIGRMTQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLPAQPGPTVL     71 - 140
AGESVTLSCSSRSSYDMYHLSREGEAHERRLPAGPKVNRTFQADSPLDPATHGGAYRCFGSFRDSPYEWS    141 - 210
KSSDPLLVSVTGNSSNSWPSPTEPSSETGNPRHLHVLIGTSVVKLPFTILLFFLLHRWCSNKKNASVMDQ    211 - 280
GPAGNRTVNREDSDEQDHQEVSYA                                                  281 - 304
//

Text Mined References (100)

PMID Year Title
26255774 2016 Diversity in KIR gene repertoire in HIV-1 exposed infected and uninfected infants: A study from India.
25724317 2015 KIR2DS5 in the presence of HLA-C C2 protects against endometriosis.
25253288 2014 Killer immunoglobulin-like receptor gene repertoire influences viral load of primary human cytomegalovirus infection in renal transplant patients.
24929143 2014 Killer-cell immunoglobulin-like receptors and falciparum malaria in southwest Nigeria.
24571473 2014 The presence of KIR2DS5 confers protection against adult immune thrombocytopenia.
24269691 2014 Allelic variation of killer cell immunoglobulin-like receptor 2DS5 impacts glycosylation altering cell surface expression levels.
23028591 2012 Killer immunoglobulin-like receptor (KIR) and HLA genotypes affect the outcome of allogeneic kidney transplantation.
22836040 2012 Activating KIR2DS5 receptor is a risk for thyroid cancer.
22652695 2012 Killer-cell immunoglobulin-like receptors (KIR) in severe A (H1N1) 2009 influenza infections.
22376216 2012 Killer cell immunoglobulin-like receptor gene polymorphisms predispose susceptibility to Epstein-Barr virus associated hemophagocytic lymphohistiocytosis in Chinese children.
More...