Property Summary

NCBI Gene PubMed Count 93
PubMed Score 0.00
PubTator Score 7.65

Knowledge Summary

Patent

No data available

Gene RIF (85)

PMID Text
26472014 genetic polymorphism is associated with childhood acute lymphoblastic leukemia among north Indians
24929143 The genes KIR2DL5, KIR2DS3 and KIR2DS5 were present in a significantly higher proportion of individuals in the asymptomatic control group than in the malaria cases.
23826153 the presence of host genetic risk factors, IL28B-T and KIR2DS3 alleles, resulted in increased odds of treatment failure in these rapid virological response negative patients.
22653583 Data found that the frequencies of KIR2DS1, 2DS3 and 3DS1 were significantly higher in pulmonary tuberculosis patients than in the control group.
22219647 KIR2DS3 and HLA-class I alleles (-Cw*14 and -Cw*17) may play a role in the pathogenesis of the Vogt-Koyanagi-Harada disease.
21402922 The Natural Killer cell gene KIR2DS3 was significantly increased in patients with chronic hepatitis C virus infection.
20878400 Study showed that the activating KIR2DS1 and KIR2DS3 genes associate with fatal outcome in Ebola virus infection.
20878400 Observational study of gene-disease association. (HuGE Navigator)
20670355 Observational study of genotype prevalence. (HuGE Navigator)
20652381 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MSLMVISMACVGFFWLQGAWPHEGFRRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGTFNDTL      1 - 70
RLIGEHIDGVSKANFSIGRMRQDLAGTYRCYGSVPHSPYQFSAPSDPLDIVITGLYEKPSLSAQPGPTVL     71 - 140
AGESVTLSCSSWSSYDMYHLSTEGEAHERRFSAGPKVNGTFQADFPLGPATQGGTYRCFGSFHDSPYEWS    141 - 210
KSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLHVLIGTSVVKLPFTILLFFLLHRWCSDKKNASVMDQ    211 - 280
GPAGNRTVNREDSDEQDHQEVSYA                                                  281 - 304
//

Text Mined References (93)

PMID Year Title
26472014 2016 Genetic associations of killer immunoglobulin like receptors and class I human leukocyte antigens on childhood acute lymphoblastic leukemia among north Indians.
24929143 2014 Killer-cell immunoglobulin-like receptors and falciparum malaria in southwest Nigeria.
23826153 2013 Variation in both IL28B and KIR2DS3 genes influence pegylated interferon and ribavirin hepatitis C treatment outcome in HIV-1 co-infection.
23394822 2013 Recombinant structures expand and contract inter and intragenic diversification at the KIR locus.
22653583 2012 Association of killer cell immunoglobulin-like receptors with pulmonary tuberculosis in Chinese Han.
22219647 2011 A study of KIR genes and HLA-C in Vogt-Koyanagi-Harada disease in Saudi Arabia.
21402922 2011 Innate immune genes synergize to predict increased risk of chronic disease in hepatitis C virus infection.
21206914 2010 Different patterns of evolution in the centromeric and telomeric regions of group A and B haplotypes of the human killer cell Ig-like receptor locus.
20878400 2010 Association of KIR2DS1 and KIR2DS3 with fatal outcome in Ebola virus infection.
20670355 2010 Diversity of killer cell immunoglobulin-like receptor genes in Indonesian populations of Sumatra, Sulawesi and Moluccas Islands.
More...