Property Summary

NCBI Gene PubMed Count 95
PubMed Score 0.00
PubTator Score 7.65

Knowledge Summary

Patent

No data available

Gene RIF (87)

AA Sequence

MSLMVISMACVGFFWLQGAWPHEGFRRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGTFNDTL      1 - 70
RLIGEHIDGVSKANFSIGRMRQDLAGTYRCYGSVPHSPYQFSAPSDPLDIVITGLYEKPSLSAQPGPTVL     71 - 140
AGESVTLSCSSWSSYDMYHLSTEGEAHERRFSAGPKVNGTFQADFPLGPATQGGTYRCFGSFHDSPYEWS    141 - 210
KSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLHVLIGTSVVKLPFTILLFFLLHRWCSDKKNASVMDQ    211 - 280
GPAGNRTVNREDSDEQDHQEVSYA                                                  281 - 304
//

Text Mined References (95)

PMID Year Title