Tbio | Nuclear factor 1 X-type |
Recognizes and binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. These proteins are individually capable of activating transcription and replication.
The protein encoded by this gene is a transcription factor that binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3 in viral and cellular promoters. The encoded protein can also stimulate adenovirus replication in vitro. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2012]
The protein encoded by this gene is a transcription factor that binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3 in viral and cellular promoters. The encoded protein can also stimulate adenovirus replication in vitro. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2012]
Comments
Disease | Target Count |
---|---|
Sotos syndrome 2 | 1 |
Disease | Target Count | P-value |
---|---|---|
lung carcinoma | 2844 | 2.4159804185632E-18 |
lung adenocarcinoma | 2714 | 4.71942518103638E-10 |
malignant mesothelioma | 3163 | 5.29751157024347E-6 |
Breast cancer | 3099 | 6.79490168396665E-6 |
invasive ductal carcinoma | 2950 | 7.0158038882382E-4 |
breast carcinoma | 1614 | 0.00100312246821111 |
ependymoma | 2514 | 0.00115534768863529 |
pituitary cancer | 1972 | 0.00244566872476055 |
oligodendroglioma | 2849 | 0.00373187431377944 |
ductal carcinoma in situ | 1745 | 0.00418182077192427 |
psoriasis | 6685 | 0.00552542361923945 |
group 4 medulloblastoma | 1875 | 0.00800367996794147 |
astrocytic glioma | 2241 | 0.00952372546053472 |
osteosarcoma | 7933 | 0.0109354649772767 |
acute myeloid leukemia | 785 | 0.0295618487353169 |
primary pancreatic ductal adenocarcinoma | 1271 | 0.0296892044362903 |
Disease | Target Count |
---|---|
Marshall-Smith syndrome | 5 |
Malan overgrowth syndrome | 1 |
Disease | log2 FC | p |
---|---|---|
malignant mesothelioma | -1.400 | 0.000 |
astrocytic glioma | 1.400 | 0.010 |
ependymoma | 2.100 | 0.001 |
oligodendroglioma | 1.600 | 0.004 |
psoriasis | -2.400 | 0.006 |
osteosarcoma | -1.207 | 0.011 |
primary pancreatic ductal adenocarcinoma | 1.001 | 0.030 |
breast carcinoma | -1.100 | 0.001 |
lung adenocarcinoma | -1.100 | 0.000 |
group 4 medulloblastoma | 1.300 | 0.008 |
acute myeloid leukemia | -1.100 | 0.030 |
lung carcinoma | -1.700 | 0.000 |
Breast cancer | -1.100 | 0.000 |
ductal carcinoma in situ | -1.400 | 0.004 |
invasive ductal carcinoma | -2.800 | 0.001 |
pituitary cancer | -1.400 | 0.002 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA EggNOG Inparanoid |
Mouse | OMA Inparanoid |
Rat | OMA EggNOG |
Dog | OMA Inparanoid |
Horse | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Pig | OMA EggNOG Inparanoid |
Opossum | OMA Inparanoid |
Anole lizard | OMA Inparanoid |
PMID | Text |
---|---|
26695693 | Plasma miR-1914* and -1915 interact with NFIX RNA. |
26653554 | miR-1290 functions as a tumor oncogene in the progression of esophageal squamous cell carcinoma by targeting NFIX |
26200704 | Report novel mutations of NFIX gene causing Marshall-Smith syndrome or Sotos-like syndrome. |
25220407 | TGF-beta-mediated suppression of ANT2 through NF1/Smad4 complexes contributes to oxidative stress and DNA damage during induction of cellular senescence. |
25118028 | NFIX analysis should be considered in patients presenting with overgrowth, macrocephaly and developmental delay including those in whom Sotos syndrome has been considered clinically but are negative for pathogenic NSD1 variants. |
24924640 | Deletions in the 3' part of the NFIX gene including a recurrent Alu-mediated deletion of exon 6 and 7 account for previously unexplained cases of Marshall-Smith syndrome. |
22422452 | DNA methylation shows genome-wide association of NFIX, RAPGEF2 and MSRB3 with gestational age at birth. |
22301465 | missense mutations in NFIX were able to cause Sotos-like features. |
21953450 | NFI-X3 and STAT3 control the migration of differentiating astrocytes as well as migration and invasion of glioma cells via regulating YKL-40 expression. |
21189253 | NFI-X3 activates GFAP expression, in part, by inducing alterations in the nucleosome architecture that lead to the increased recruitment of RNA polymerase II |
More... |
MYSPYCLTQDEFHPFIEALLPHVRAFSYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLGEKPEIKQK 1 - 70 WASRLLAKLRKDIRPEFREDFVLTITGKKPPCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGI 71 - 140 PLESTDGERLYKSPQCSNPGLCVQPHHIGVTIKELDLYLAYFVHTPESGQSDSSNQQGDADIKPLPNGHL 141 - 210 SFQDCFVTSGVWNVTELVRVSQTPVATASGPNFSLADLESPSYYNINQVTLGRRSITSPPSTSTTKRPKS 211 - 280 IDDSEMESPVDDVFYPGTGRSPAAGSSQSSGWPNDVDAGPASLKKSGKLDFCSALSSQGSSPRMAFTHHP 281 - 350 LPVLAGVRPGSPRATASALHFPSTSIIQQSSPYFTHPTIRYHHHHGQDSLKEFVQFVCSDGSGQATGQPN 351 - 420 GSGQGKVPGSFLLPPPPPVARPVPLPMPDSKSTSTAPDGAALTPPSPSFATTGASSANRFVSIGPRDGNF 421 - 490 LNIPQQSQSWFL 491 - 502 //
PMID | Year | Title |
---|---|---|
26695693 | 2016 | The Plasma microRNA miR-1914* and -1915 Suppresses Chemoresistant in Colorectal Cancer Patients by Down-regulating NFIX. |
26653554 | 2015 | MiR-1290 promotes cancer progression by targeting nuclear factor I/X(NFIX) in esophageal squamous cell carcinoma (ESCC). |
26200704 | 2015 | Novel mutations of NFIX gene causing Marshall-Smith syndrome or Sotos-like syndrome: one gene, two phenotypes. |
25416956 | 2014 | A proteome-scale map of the human interactome network. |
25220407 | 2014 | TGF-?/NF1/Smad4-mediated suppression of ANT2 contributes to oxidative stress in cellular senescence. |
25187353 | 2014 | Clozapine-induced agranulocytosis is associated with rare HLA-DQB1 and HLA-B alleles. |
25118028 | 2015 | Malan syndrome: Sotos-like overgrowth with de novo NFIX sequence variants and deletions in six new patients and a review of the literature. |
24924640 | 2014 | Deletions in the 3' part of the NFIX gene including a recurrent Alu-mediated deletion of exon 6 and 7 account for previously unexplained cases of Marshall-Smith syndrome. |
24275569 | 2014 | An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. |
23186163 | 2013 | Toward a comprehensive characterization of a human cancer cell phosphoproteome. |
More... |