Property Summary

NCBI Gene PubMed Count 35
Grant Count 11
R01 Count 5
Funding $696,308.99
PubMed Score 43.64
PubTator Score 38.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
malignant mesothelioma -1.400 0.000
astrocytic glioma 1.400 0.010
ependymoma 2.100 0.001
oligodendroglioma 1.600 0.004
psoriasis -2.400 0.006
osteosarcoma -1.207 0.011
primary pancreatic ductal adenocarcinoma 1.001 0.030
breast carcinoma -1.100 0.001
lung adenocarcinoma -1.100 0.000
group 4 medulloblastoma 1.300 0.008
acute myeloid leukemia -1.100 0.030
lung carcinoma -1.700 0.000
Breast cancer -1.100 0.000
ductal carcinoma in situ -1.400 0.004
invasive ductal carcinoma -2.800 0.001
pituitary cancer -1.400 0.002

Gene RIF (16)

PMID Text
26695693 Plasma miR-1914* and -1915 interact with NFIX RNA.
26653554 miR-1290 functions as a tumor oncogene in the progression of esophageal squamous cell carcinoma by targeting NFIX
26200704 Report novel mutations of NFIX gene causing Marshall-Smith syndrome or Sotos-like syndrome.
25220407 TGF-beta-mediated suppression of ANT2 through NF1/Smad4 complexes contributes to oxidative stress and DNA damage during induction of cellular senescence.
25118028 NFIX analysis should be considered in patients presenting with overgrowth, macrocephaly and developmental delay including those in whom Sotos syndrome has been considered clinically but are negative for pathogenic NSD1 variants.
24924640 Deletions in the 3' part of the NFIX gene including a recurrent Alu-mediated deletion of exon 6 and 7 account for previously unexplained cases of Marshall-Smith syndrome.
22422452 DNA methylation shows genome-wide association of NFIX, RAPGEF2 and MSRB3 with gestational age at birth.
22301465 missense mutations in NFIX were able to cause Sotos-like features.
21953450 NFI-X3 and STAT3 control the migration of differentiating astrocytes as well as migration and invasion of glioma cells via regulating YKL-40 expression.
21189253 NFI-X3 activates GFAP expression, in part, by inducing alterations in the nucleosome architecture that lead to the increased recruitment of RNA polymerase II
More...

AA Sequence

MYSPYCLTQDEFHPFIEALLPHVRAFSYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLGEKPEIKQK      1 - 70
WASRLLAKLRKDIRPEFREDFVLTITGKKPPCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGI     71 - 140
PLESTDGERLYKSPQCSNPGLCVQPHHIGVTIKELDLYLAYFVHTPESGQSDSSNQQGDADIKPLPNGHL    141 - 210
SFQDCFVTSGVWNVTELVRVSQTPVATASGPNFSLADLESPSYYNINQVTLGRRSITSPPSTSTTKRPKS    211 - 280
IDDSEMESPVDDVFYPGTGRSPAAGSSQSSGWPNDVDAGPASLKKSGKLDFCSALSSQGSSPRMAFTHHP    281 - 350
LPVLAGVRPGSPRATASALHFPSTSIIQQSSPYFTHPTIRYHHHHGQDSLKEFVQFVCSDGSGQATGQPN    351 - 420
GSGQGKVPGSFLLPPPPPVARPVPLPMPDSKSTSTAPDGAALTPPSPSFATTGASSANRFVSIGPRDGNF    421 - 490
LNIPQQSQSWFL                                                              491 - 502
//

Text Mined References (40)

PMID Year Title
26695693 2016 The Plasma microRNA miR-1914* and -1915 Suppresses Chemoresistant in Colorectal Cancer Patients by Down-regulating NFIX.
26653554 2015 MiR-1290 promotes cancer progression by targeting nuclear factor I/X(NFIX) in esophageal squamous cell carcinoma (ESCC).
26200704 2015 Novel mutations of NFIX gene causing Marshall-Smith syndrome or Sotos-like syndrome: one gene, two phenotypes.
25416956 2014 A proteome-scale map of the human interactome network.
25220407 2014 TGF-?/NF1/Smad4-mediated suppression of ANT2 contributes to oxidative stress in cellular senescence.
25187353 2014 Clozapine-induced agranulocytosis is associated with rare HLA-DQB1 and HLA-B alleles.
25118028 2015 Malan syndrome: Sotos-like overgrowth with de novo NFIX sequence variants and deletions in six new patients and a review of the literature.
24924640 2014 Deletions in the 3' part of the NFIX gene including a recurrent Alu-mediated deletion of exon 6 and 7 account for previously unexplained cases of Marshall-Smith syndrome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...