Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.17
PubTator Score 1.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Obesity 678 0.0 0.0
Disease Target Count P-value
medulloblastoma, large-cell 6241 2.7e-04
atypical teratoid / rhabdoid tumor 5112 5.5e-04
astrocytic glioma 2597 4.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Acquired metabolic disease 336 0.0 1.9

Expression

  Differential Expression (3)

Disease log2 FC p
astrocytic glioma 1.100 4.6e-02
atypical teratoid / rhabdoid tumor 1.100 5.5e-04
medulloblastoma, large-cell 1.600 2.7e-04

AA Sequence

MSPGLLTTRKEALMAFRDVAVAFTQKEWKLLSSAQRTLYREVMLENYSHLVSLGIAFSKPKLIEQLEQGD      1 - 70
EPWREENEHLLDLCPEPRTEFQPSFPHLVAFSSSQLLRQYALSGHPTQIFPSSSAGGDFQLEAPRCSSEK     71 - 140
GESGETEGPDSSLRKRPSRISRTFFSPHQGDPVEWVEGNREGGTDLRLAQRMSLGGSDTMLKGADTSESG    141 - 210
AVIRGNYRLGLSKKSSLFSHQKHHVCPECGRGFCQRSDLIKHQRTHTGEKPYLCPECGRRFSQKASLSIH    211 - 280
QRKHSGEKPYVCRECGRHFRYTSSLTNHKRIHSGERPFVCQECGRGFRQKIALLLHQRTHLEEKPFVCPE    281 - 350
CGRGFCQKASLLQHQSSHTGERPFLCLECGRSFRQQSLLLSHQVTHSGEKPYVCAECGHSFRQKVTLIRH    351 - 420
QRTHTGEKPYLCPQCGRGFSQKVTLIGHQRTHTGEKPYLCPDCGRGFGQKVTLIRHQRTHTGEKPYLCPK    421 - 490
CGRAFGFKSLLTRHQRTHSEEELYVDRVCGQGLGQKSHLISDQRTHSGEKPCICDECGRGFGFKSALIRH    491 - 560
QRTHSGEKPYVCRECGRGFSQKSHLHRHRRTKSGHQLLPQEVF                               561 - 603
//

Text Mined References (12)

PMID Year Title