Property Summary

NCBI Gene PubMed Count 23
Grant Count 16
R01 Count 16
Funding $1,076,212.75
PubMed Score 10.65
PubTator Score 14.75

Knowledge Summary

Patent

No data available

Expression

Gene RIF (5)

PMID Text
19204005 heterodimerization with NC2alpha masks the nuclear localization signal in NC2beta, which prevents nuclear export of the NC2 complex
17994103 provide evidence that negative cofactor-2 (NC2) induces dynamic conformational changes in the TBP-DNA complex that allow it to escape and return to TATA-binding mode
17548813 The global distribution of DRAP1 on promoters was determined.
15509807 physical cooperation between BTAF1 and NC2alpha in TBP regulation
12477712 Hypoxia actively represses transcription by inducing this protein and blocking preinitiation complex assembly.

AA Sequence

MPSKKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTMTTSHL      1 - 70
KQCIELEQQFDFLKDLVASVPDMQGDGEDNHMDGDKGARRGRKPGSGGRKNGGMGTKSKDKKLSGTDSEQ     71 - 140
EDESEDTDTDGEEETSQPPPQASHPSAHFQSPPTPFLPFASTLPLPPAPPGPSAPDEEDEEDYDS         141 - 205
//

Text Mined References (25)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25416956 2014 A proteome-scale map of the human interactome network.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
19204005 2009 Regulation of nuclear import and export of negative cofactor 2.
17994103 2007 NC2 mobilizes TBP on core promoter TATA boxes.
17548813 2007 Global distribution of negative cofactor 2 subunit-alpha on human promoters.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
More...