Property Summary

NCBI Gene PubMed Count 31
Grant Count 3
Funding $52,716.56
PubMed Score 42.91
PubTator Score 51.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
nephrosclerosis -1.432 0.033
atypical teratoid / rhabdoid tumor 1.200 0.007
glioblastoma 1.100 0.006
medulloblastoma, large-cell 1.700 0.000
adult high grade glioma 1.400 0.001
group 4 medulloblastoma 1.100 0.011
ovarian cancer 1.400 0.000

Synonym

Accession Q14916 A8K418 O60761 Q13783 Q3MIP5 Q5MJP8 Q5TB83 Q96KL8
Symbols NPT1
NPT-1
NAPI-1

Gene

PANTHER Protein Class (2)

Gene RIF (18)

PMID Text
26663070 Data suggest that single nucleotide polymorphisms (SNPs) rs9467596 and rs2096386 of the solute carrier family 17 (sodium phosphate), member 1 protein (SLC17A1) gene may have a correlation between hyperuricemia and alcohol drinking among Uygur patients.
26524967 Data suggest that single nucleotide polymorphisms (SNPs) of solute carrier family 17 member 1 (SLC17A1) are potential biomarkers for altered cholesterol homeostasis and hyperhomocysteinaemia in Japanese men.
26290326 Polymorphisms in GCKR, SLC17A1 and SLC22A12 were associated with phenotype gout in Han Chinese males.
25252215 NPT1/SLC17A1 is a renal urate exporter in humans and its common gain-of-function variant decreases the risk of renal underexcretion gout.
23876149 NPT1 is responsible for urate excretion under physiological conditions and its impairment is linked with the occurrence of gout. [review]
23852697 We observed a clear effect of SLC17A1 genotype on fructose load in Europeans but not Polynesian subgroups.
22541845 Renal urate transporter SLC17A1 is the third locus associated with gout at a genome-wide level of significance.
20927387 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20884846 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20566650 results strongly suggested that NPT1 is a Cl(-)-dependent polyspecific anion exporter involved in urate excretion under physiological conditions
More...

AA Sequence

MQMDNRLPPKKVPGFCSFRYGLSFLVHCCNVIITAQRACLNLTMVVMVNSTDPHGLPNTSTKKLLDNIKN      1 - 70
PMYNWSPDIQGIILSSTSYGVIIIQVPVGYFSGIYSTKKMIGFALCLSSVLSLLIPPAAGIGVAWVVVCR     71 - 140
AVQGAAQGIVATAQFEIYVKWAPPLERGRLTSMSTSGFLLGPFIVLLVTGVICESLGWPMVFYIFGACGC    141 - 210
AVCLLWFVLFYDDPKDHPCISISEKEYITSSLVQQVSSSRQSLPIKAILKSLPVWAISTGSFTFFWSHNI    211 - 280
MTLYTPMFINSMLHVNIKENGFLSSLPYLFAWICGNLAGQLSDFFLTRNILSVIAVRKLFTAAGFLLPAI    281 - 350
FGVCLPYLSSTFYSIVIFLILAGATGSFCLGGVFINGLDIAPRYFGFIKACSTLTGMIGGLIASTLTGLI    351 - 420
LKQDPESAWFKTFILMAAINVTGLIFYLIVATAEIQDWAKEKQHTRL                           421 - 467
//

Text Mined References (34)

PMID Year Title
26663070 2015 [Polymorphisms of SLC17A1 gene and their interaction with alcohol drinking among Uygur patients with hyperuricemia].
26524967 2015 Genetic variants of SLC17A1 are associated with cholesterol homeostasis and hyperhomocysteinaemia in Japanese men.
26290326 2015 Polymorphisms in GCKR, SLC17A1 and SLC22A12 were associated with phenotype gout in Han Chinese males: a case-control study.
25252215 2015 NPT1/SLC17A1 is a renal urate exporter in humans and its common gain-of-function variant decreases the risk of renal underexcretion gout.
24816252 2014 An atlas of genetic influences on human blood metabolites.
23876149 2013 Type 1 sodium-dependent phosphate transporter acts as a membrane potential-driven urate exporter.
23852697 2014 Population-specific effects of SLC17A1 genotype on serum urate concentrations and renal excretion of uric acid during a fructose load.
23263486 2013 Genome-wide association analyses identify 18 new loci associated with serum urate concentrations.
22541845 2012 The renal urate transporter SLC17A1 locus: confirmation of association with gout.
21983786 2011 Identification of low-frequency variants associated with gout and serum uric acid levels.
More...