Property Summary

NCBI Gene PubMed Count 17
PubMed Score 21.11
PubTator Score 21.25

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q14914 A8K0N2 B4DPK3 F5GY50 Q8IYQ0 Q9H1X6 PRG-1
Symbols PGR1
ZADH3
LTB4DH

Gene

PANTHER Protein Class (2)

PDB

1ZSV   2Y05  

 GWAS Trait (1)

Gene RIF (7)

PMID Text
26823768 PTGR1 may be an oncogene in human gastric carcinoma and identified as a diagnosis and prognosis target for gastric carcinoma.
25179160 selenium had only a minor influence on prostaglandin reductase 1 (PTGR1) and NAD(P)H:quinone oxidoreductase 1 (NQO1) activity and protein levels
23878198 These results situate PtGR-1 as a critical modulator of both the steady state levels and signaling activities of fatty acid nitroalkenes in vivo.
20804502 Data show that two genes, LTB4DH and DPYSL3, were confirmed to be candidate genes for the predictor of a good immune response.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19595472 restoration of expression in enzyme-negative lung cancer cell lines induces apoptosis and growth inhibition

AA Sequence

MVRTKTWTLKKHFVGYPTNSDFELKTAELPPLKNGEVLLEALFLTVDPYMRVAAKRLKEGDTMMGQQVAK      1 - 70
VVESKNVALPKGTIVLASPGWTTHSISDGKDLEKLLTEWPDTIPLSLALGTVGMPGLTAYFGLLEICGVK     71 - 140
GGETVMVNAAAGAVGSVVGQIAKLKGCKVVGAVGSDEKVAYLQKLGFDVVFNYKTVESLEETLKKASPDG    141 - 210
YDCYFDNVGGEFSNTVIGQMKKFGRIAICGAISTYNRTGPLPPGPPPEIVIYQELRMEAFVVYRWQGDAR    211 - 280
QKALKDLLKWVLEGKIQYKEYIIEGFENMPAAFMGMLKGDNLGKTIVKA                         281 - 329
//

Text Mined References (19)

PMID Year Title
26823768 2015 Effect of prostaglandin reductase 1 (PTGR1) on gastric carcinoma using lentivirus-mediated system.
25179160 2015 Induction of complementary function reductase enzymes in colon cancer cells by dithiole-3-thione versus sodium selenite.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23878198 2013 Modulation of nitro-fatty acid signaling: prostaglandin reductase-1 is a nitroalkene reductase.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23314186 2013 Genetic variation associated with circulating monocyte count in the eMERGE Network.
21269460 2011 Initial characterization of the human central proteome.
20804502 2010 A set of genes associated with the interferon-? response of lung cancer patients undergoing ?-galactosylceramide-pulsed dendritic cell therapy.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
More...