Property Summary

NCBI Gene PubMed Count 17
PubMed Score 21.11
PubTator Score 21.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 1.71214578240237E-6
ulcerative colitis 2087 1.71537449040578E-6
nasopharyngeal carcinoma 1056 3.12048380036521E-6
psoriasis 6685 9.23994771063369E-6
interstitial cystitis 2299 1.70468161427133E-5
ovarian cancer 8492 1.67271663299193E-4
osteosarcoma 7933 2.6976305512703E-4
Pick disease 1893 6.80184765565376E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 7.56247578039211E-4
posterior fossa group B ependymoma 1530 0.00108320710312411
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00197214257115229
invasive ductal carcinoma 2950 0.00349563833546967
primitive neuroectodermal tumor 3031 0.0100738384840215
progressive supranuclear palsy 674 0.0137383446860181
aldosterone-producing adenoma 664 0.0142808225784196
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0205273492277707
urothelial carcinoma 318 0.0420081689490543
astrocytic glioma 2241 0.0453694854115456

Expression

Synonym

Accession Q14914 A8K0N2 B4DPK3 F5GY50 Q8IYQ0 Q9H1X6 PRG-1
Symbols PGR1
ZADH3
LTB4DH

Gene

PANTHER Protein Class (2)

PDB

1ZSV   2Y05  

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
S.cerevisiae OMA EggNOG

 GWAS Trait (1)

Gene RIF (7)

PMID Text
26823768 PTGR1 may be an oncogene in human gastric carcinoma and identified as a diagnosis and prognosis target for gastric carcinoma.
25179160 selenium had only a minor influence on prostaglandin reductase 1 (PTGR1) and NAD(P)H:quinone oxidoreductase 1 (NQO1) activity and protein levels
23878198 These results situate PtGR-1 as a critical modulator of both the steady state levels and signaling activities of fatty acid nitroalkenes in vivo.
20804502 Data show that two genes, LTB4DH and DPYSL3, were confirmed to be candidate genes for the predictor of a good immune response.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19595472 restoration of expression in enzyme-negative lung cancer cell lines induces apoptosis and growth inhibition

AA Sequence

MVRTKTWTLKKHFVGYPTNSDFELKTAELPPLKNGEVLLEALFLTVDPYMRVAAKRLKEGDTMMGQQVAK      1 - 70
VVESKNVALPKGTIVLASPGWTTHSISDGKDLEKLLTEWPDTIPLSLALGTVGMPGLTAYFGLLEICGVK     71 - 140
GGETVMVNAAAGAVGSVVGQIAKLKGCKVVGAVGSDEKVAYLQKLGFDVVFNYKTVESLEETLKKASPDG    141 - 210
YDCYFDNVGGEFSNTVIGQMKKFGRIAICGAISTYNRTGPLPPGPPPEIVIYQELRMEAFVVYRWQGDAR    211 - 280
QKALKDLLKWVLEGKIQYKEYIIEGFENMPAAFMGMLKGDNLGKTIVKA                         281 - 329
//

Text Mined References (19)

PMID Year Title
26823768 2015 Effect of prostaglandin reductase 1 (PTGR1) on gastric carcinoma using lentivirus-mediated system.
25179160 2015 Induction of complementary function reductase enzymes in colon cancer cells by dithiole-3-thione versus sodium selenite.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23878198 2013 Modulation of nitro-fatty acid signaling: prostaglandin reductase-1 is a nitroalkene reductase.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23314186 2013 Genetic variation associated with circulating monocyte count in the eMERGE Network.
21269460 2011 Initial characterization of the human central proteome.
20804502 2010 A set of genes associated with the interferon-? response of lung cancer patients undergoing ?-galactosylceramide-pulsed dendritic cell therapy.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
More...