Property Summary

NCBI Gene PubMed Count 18
PubMed Score 22.69
PubTator Score 21.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Gene RIF (8)

AA Sequence

MVRTKTWTLKKHFVGYPTNSDFELKTAELPPLKNGEVLLEALFLTVDPYMRVAAKRLKEGDTMMGQQVAK      1 - 70
VVESKNVALPKGTIVLASPGWTTHSISDGKDLEKLLTEWPDTIPLSLALGTVGMPGLTAYFGLLEICGVK     71 - 140
GGETVMVNAAAGAVGSVVGQIAKLKGCKVVGAVGSDEKVAYLQKLGFDVVFNYKTVESLEETLKKASPDG    141 - 210
YDCYFDNVGGEFSNTVIGQMKKFGRIAICGAISTYNRTGPLPPGPPPEIVIYQELRMEAFVVYRWQGDAR    211 - 280
QKALKDLLKWVLEGKIQYKEYIIEGFENMPAAFMGMLKGDNLGKTIVKA                         281 - 329
//

Text Mined References (20)

PMID Year Title